DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Or24a and LOC1271315

DIOPT Version :10

Sequence 1:NP_523470.3 Gene:Or24a / 33623 FlyBaseID:FBgn0026394 Length:398 Species:Drosophila melanogaster
Sequence 2:XP_061513940.1 Gene:LOC1271315 / 1271315 VectorBaseID:AGAMI1_009294 Length:83 Species:Anopheles gambiae


Alignment Length:35 Identity:12/35 - (34%)
Similarity:15/35 - (42%) Gaps:7/35 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 KSAKEARIRRPMNAFMVWAKVERKKLADENP-DLH 191
            |.|.||.|:      ..:.|:..|...|.|| |.|
Mosquito    43 KMASEAEIK------SAYRKLALKYHPDRNPNDAH 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Or24aNP_523470.3 7tm_6 68..388 CDD:251636 12/35 (34%)
LOC1271315XP_061513940.1 None

Return to query results.
Submit another query.