DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TTLL4B and Ttll4

Sequence 1:NP_001260010.1 Gene:TTLL4B FlyBaseID:FBgn0031574 Length:989 Species:Drosophila melanogaster
Sequence 2:XP_001074653.1 Gene:Ttll4 RGDID:1594742 Length:1198 Species:Rattus norvegicus

Alignment Length:971 Identity:323/972 (33%)
Similarity:476/972 (49%) Gaps:171/972 (18%)


  Fly    78 PASSHHLQPH--LAAPNRNHGRIVQSSTPQHRSSAGGGSAAGATA---------------SDSVS 125
            |.:|....|:  |||...|..|       :..|||..|..|...:               |..|.
  Rat   173 PMASSPTDPYLSLAAAGENPSR-------KSLSSAISGKIASPLSSYKPMLNNNSFMRPNSTKVP 230

  Fly   126 ARYSPPGQKQRSPPSPRKRLTPEKVANLGGGG------GGSKVGAQRIIIRGTPPNS-------- 176
            ...:..|.|..|.|    ::.|....:.||.|      |..||           |.|        
  Rat   231 LSQATDGLKPVSSP----KIQPVSWHHSGGTGDCVPQPGDHKV-----------PQSIATVLDDV 280

  Fly   177 STPKVAATPSNVPVVANSVLQSEPYKKVQMLLKRAREEAFAKHTAG-NSAANGNGPKRSAH-SPP 239
            :.|...:|||.:.:...||..|      |......|.||   |..| :...:.....:..| :..
  Rat   281 TAPMAPSTPSTLNISTASVASS------QCSQSNFRREA---HPCGLDENTDSQSATKEVHFTEA 336

  Fly   240 IQ-------AKVPPSNMSCPSTQTLKPSPPSKIVVNSFHGSSMLSTQQQEEKSRLLTQNGLTKSA 297
            ::       .|:|...........:.||....::..|.....::..:..:|...|  .:|:...|
  Rat   337 VRKLAAKGFEKMPRQGYQFEQACFVNPSFQWGLLNRSRRWKPLMGQRFPQEDIGL--DSGILPGA 399

  Fly   298 A--TALETSLYA----SLYANAPQ----NSQPQFHS---PRISGGD----------------HVA 333
            :  ..|:::::.    |::..|..    |..|...|   |::.|.|                .||
  Rat   400 SDTLGLDSTVFCTKRISIHLLASHVHGLNPSPTCGSVVDPQLLGEDRAPVPPSSSLQPLGVAEVA 464

  Fly   334 SYVGVSLNKG-AGHDNDRKHEDDPCAAIDDINYYD-------DSDSEEEYVGTPFFLE-----ED 385
            :.:. |::.| .|.:.:...:.:.|:...|.:..|       ..|||:| :|..  ||     ::
  Rat   465 TRLS-SVHLGQPGKEPEEAKDLNSCSTKGDCSPTDLRPKQLEPEDSEDE-LGDG--LEDSCSHDE 525

  Fly   386 NTETRQSKHTRLLPQKTPSKESV-----RTTDSEASVYFRPEAILSP----SLFPHVPPYLNFTS 441
            |.|.........|...:|| |||     ...|..:......|.::.|    ||||:|.|.:.|.:
  Rat   526 NEEEEGDSECSSLSVVSPS-ESVAIISRNCVDLMSKSISNHEKVVRPALIYSLFPNVSPTIYFGT 589

  Fly   442 HADKGPPMPAALHRVLKWKLSPVMPKIVKRVVLNSGFRIIKNTTDWMAVWEKHMKSPGFRTIRSH 506
            ..::...:|....|:|:||:|.|.|.|||:.:..|.|:|.|...||:..|..||||||||:||.|
  Rat   590 RDERVEKLPWEQRRLLRWKMSTVTPNIVKQTIGRSHFKISKRNDDWLGCWGHHMKSPGFRSIREH 654

  Fly   507 QKYNHIPGSFRIGRKDTMWRSIYNNMKKFGKKEFGFMQKSYIMPDDLESLRQVWPKNASKLTKWI 571
            ||.||.||||:|||||.:||::.....:||||||.|..:|:|:|.|.:.||:.|  .:|...|||
  Rat   655 QKLNHFPGSFQIGRKDRLWRNLSRMQSRFGKKEFSFFPQSFILPQDSKLLRKAW--ESSSRQKWI 717

  Fly   572 VKPPASARGTGIRIVNKWSQFPKDRPLVVQKYIERPLLINDNKFDMRLYVVLTSINPLRIYMYKD 636
            |||||||||.||::::||||.||.|||:||:|:.:|.||:.:|||:|:||.:||.:|||||::.|
  Rat   718 VKPPASARGIGIQVIHKWSQLPKRRPLLVQRYLHKPYLISGSKFDLRIYVYVTSYDPLRIYLFSD 782

  Fly   637 GLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQGHKWTLQSLWSCLENRGVN 701
            ||.||||.|||..:.:|..:.|||||||:||.:..|..|.|..|||||||.|::||:.|..:|||
  Rat   783 GLVRFASCKYSPSMKSLSNKFMHLTNYSVNKKNAEYQANADETACQGHKWALKALWNYLSQKGVN 847

  Fly   702 TKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFGFDVLLDENLVPWLLEINISPSLH 766
            :..:|..::::|:|.|:|.|..:..:.:..|...|:|.||||||::|||||.||:||:|||||||
  Rat   848 SDAIWEKIKDVVVKTIISSEPYVTNLLKLYVRRPYSCHELFGFDIMLDENLKPWVLEVNISPSLH 912

  Fly   767 SELPLDLHVKGPLIQAVLNTALYQVPPKLNERQQADIL---------------------EELNLT 810
            |..|||:.:||.:|:.:||.|.:.:|      ...|||                     |:..:|
  Rat   913 SNSPLDISIKGQMIRDLLNLAGFVLP------NMEDILSSSSSPSSSSGSSTSLPSSPREKCQMT 971

  Fly   811 GPLCHDKRIFTTCLTAEEVRKHNQYTNRSIEFREEYVDTILDNLLPDDVRCLIVAEDELARCQPL 875
            ..  |        .||::::|....|.:..:  :::..::||.|.|||||.|:..|||.:|....
  Rat   972 PE--H--------FTAQKMKKAYYLTQKVPD--QDFYSSVLDVLTPDDVRVLVEMEDEFSRRGQF 1024

  Fly   876 ERIFPTAGTHVYLRYVENARYYNRLLDAWETKYAKNREMGIALLSRYCRDKYHLQ-VSDAA 935
            |||||:..:..|||:.|..||:|.|...||.||..|:..|:.||..:|...:|.. |||:|
  Rat  1025 ERIFPSRISSRYLRFFEQPRYFNILTTQWEQKYHGNKLKGVDLLRNWCYKGFHTGIVSDSA 1085

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TTLL4BNP_001260010.1 TTL 504..799 CDD:281171 153/295 (52%)
Ttll4XP_001074653.1 TTL 652..943 CDD:281171 154/299 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C333482960
eggNOG 1 0.900 E1_KOG2156
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D250453at33208
OrthoFinder 1 1.000 FOG0004914
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_128244
Panther 1 1.100 O PTHR12241
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.