DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: TTLL4B and TTLL3A

Sequence 1:NP_001260010.1 Gene:TTLL4B FlyBaseID:FBgn0031574 Length:989 Species:Drosophila melanogaster
Sequence 2:NP_609069.1 Gene:TTLL3A FlyBaseID:FBgn0031854 Length:992 Species:Drosophila melanogaster

Alignment Length:737 Identity:170/738 (23%)
Similarity:271/738 (37%) Gaps:231/738 (31%)


  Fly   130 PPGQKQRS----PPSPRKRLTPEKVANLGGGGGGSKVGAQRIIIRGTPPNSSTPKVAATPSN--- 187
            |..:..||    ....|.|..|:|.|        |...|::.:   |||.:..|    ||||   
  Fly     5 PSSEPHRSRDQVTDGDRNRDQPQKCA--------SATLAKKPV---TPPAAPPP----TPSNRVV 54

  Fly   188 ----VPVVANSVLQSE-PYKKVQMLLKRAREEAFAKHTAGNSAANGNGPKRSAHSPPIQAKVPPS 247
                |||:..:..||: |       :|.|| .|..|.||.:...:.|...:.|.:|      |||
  Fly    55 APLTVPVIQLTPAQSDSP-------VKLAR-PATPKETAISVPDHSNKENQPARTP------PPS 105

  Fly   248 NMSCPSTQTLKPSPPSKIVVNSFHGSSMLSTQQQEE----------KSRLLTQNGLTKSAATAL- 301
            . |||.      ..|:..|..    .:.::|::..|          ::::.|..|...|...|| 
  Fly   106 K-SCPL------GAPTNYVAR----RTWITTERMNELRRKAQEAAKQNKIFTIRGCFNSVRNALL 159

  Fly   302 -----------------ETSLYASLYANAP----------------QNSQPQF--HSP------- 324
                             ....|..|....|                :|...:|  |.|       
  Fly   160 MRGWVEKLDVHRKVMPAGQMTYEDLTQRLPKRKAGETRRQYVQKCERNIMSRFLEHMPVDFLWTN 224

  Fly   325 RISGGDHV--ASYVGVSLNKGAGHDNDRKHEDDPCAAIDDINYYDDSDSEEEY------VGTPFF 381
            |....|::  |...|:::||  .|......::..|:.:.|.:::.:..:.|.|      |.:|..
  Fly   225 RKEKCDYIDQAKNPGMTINK--FHRAPFTSKEGLCSQLRDFHWFFEEGTAEMYFPRCYNVWSPEE 287

  Fly   382 LEE--DNTE-TRQSKHTRLLPQKTPSKESVRTTDSEASVYFRPEAILSPS----------LFPHV 433
            |.|  :|.: |......|.:..|...:.|              :|:.|.|          .:..:
  Fly   288 LGEFIENFKLTACVAFLRAMLCKYHKQGS--------------DAVFSCSGKIPYSAIDFAYKRL 338

  Fly   434 PPYLNFTSHADKGPPMPAALHRVLKWKLSPVMPKIVKRVVLNSGFRIIKNTTDWMAVWEKHMKSP 498
            ..|::...|.|.....|               |||.:.              ||.|...:|.   
  Fly   339 VEYIDSCQHNDIDFEDP---------------PKIWEH--------------DWDAFLFQHQ--- 371

  Fly   499 GFRTIRSHQKYNHIPGSFRIGRKDTMWRSIYNNMKKFGKKEFGFMQKSYIMPDDLESLRQVWPKN 563
              :.:....:..|..|.    |.:.|.:|..:.:.|                     ::..||:.
  Fly   372 --QLVNEDGRIQHDGGQ----RLEPMVKSCLSLVDK---------------------MKVHWPQY 409

  Fly   564 A--SKLTKWIVKPPASARGTGIRIVNKWSQF---------PKDRPLVVQKYIERPLLINDNKFDM 617
            :  .....|||||....||.||.:::...:.         .|.| .||||||||||::...|||:
  Fly   410 SLDGYQNMWIVKPANKCRGRGIILMDNLKKILGVVNLSIASKSR-YVVQKYIERPLILFQTKFDI 473

  Fly   618 RLYVVLTSINPLRIYMYKDGLARFASVKYSSELSNLDERCMHLTNYSINKFSQNYAKNEDFNACQ 682
            |.:.::|:..||.::.|::...||:|.:||  |||..| .:|||||:|.|...|..:::      
  Fly   474 RQWFLITNTQPLVVWFYRESYLRFSSQEYS--LSNHHE-SVHLTNYAIQKKYTNGKRDK------ 529

  Fly   683 GHKWTLQSLWSCLE----NRGVNTKRLWATLRNLVIKGIVSGESGLNRMYRQNVNFRYNCFELFG 743
              :...:::|.|..    .|.:....:|.   ..:..|:.....|.....::|::.|.|.|||||
  Fly   530 --RLPSENMWDCYSFQAYLRQIGKYNMWL---ERIFPGMRKAIVGCMLASQENMDRRPNTFELFG 589

  Fly   744 FDVLLDENLVPWLLEINISPSL 765
            .|.::.||..|||:|||.||.|
  Fly   590 ADFMICENFYPWLIEINSSPDL 611

Known Domains:


GeneSequenceDomainRegion External IDIdentity
TTLL4BNP_001260010.1 TTL 504..799 CDD:281171 80/278 (29%)
TTLL3ANP_609069.1 TTL 342..640 CDD:281171 90/345 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C108329714
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.