DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3407 and pita

Sequence 1:NP_608809.1 Gene:CG3407 FlyBaseID:FBgn0031573 Length:714 Species:Drosophila melanogaster
Sequence 2:NP_611806.3 Gene:pita FlyBaseID:FBgn0034878 Length:683 Species:Drosophila melanogaster

Alignment Length:474 Identity:116/475 (24%)
Similarity:179/475 (38%) Gaps:95/475 (20%)


  Fly   268 ATDKLNAVVVNTSSTPNSVPVVDDVEFSDTEDMLEGIRNVVDKVSIEDTCDELVDLELTSSGMTA 332
            |:.||..|...|:. |:..|          :.:|..:.....:|.||       |:::..|.|..
  Fly   114 ASKKLLVVPAKTAE-PSETP----------KKLLNTMAKSSSQVIIE-------DVQVLESAMVT 160

  Fly   333 PWFNNNFRDITFPALLLPGEPPPASS-----------------------EPATPLLKENPHVGDH 374
                        |..:....|.|..|                       :.|:.|.||.|.:   
  Fly   161 ------------PRTVAGSSPVPRRSHAYELKVDNNQELSMDDVQSMLEDMASELEKEFPDI--- 210

  Fly   375 MALDFLSPEKADPQEEAKLEKTLSKACEPNEQTLLVAPPACQTPPIPTVPPANSSI-EQLRRSPL 438
                   |:||.|.:...|.|:..:..  |:.......|...||.:......|.:| .::..|.|
  Fly   211 -------PQKASPVKPKVLNKSSIRIL--NKGPAAPVEPRLATPKVKRDDSGNVAIVTEVLDSDL 266

  Fly   439 ELSEAFKLEEDDMTDSRPASSFEEGDPDAEEPNECFQMEVLDTSLTEEAENKTRRKHF-CDKCNR 502
            .|        ||..|  |..:.|:...|.....:|.:...|...|.....|.||.:.| |..|.:
  Fly   267 PL--------DDQDD--PTKNAEKVATDVFPCPDCERSFPLQQLLEIHRLNHTRSRSFQCLLCEK 321

  Fly   503 DFNSYNALKYHQYTHNQERSHKCDSCERSFYTQSALKAHERTHSGVKPFKCDKCEFQFRQWGDLK 567
            .|.|...|..|.:.|..||..||..|.::|..::.|..|||||:.|..|.|..||..|....:::
  Fly   322 SFFSKYDLAKHNFVHTGERPFKCAICSKAFTRKALLHRHERTHTDVPKFICVYCEKPFLSRQEME 386

  Fly   568 YHIISRHSDVKAHMCEFCGKSFSRRYSLVVHRRIHTREKNYACQYCDKTFRASSYLLSHIKVHTG 632
            .| ..||...:...|..|.|||:.:..|..|..:|:....:.||:|:::|..:|.|..|:..|.|
  Fly   387 KH-AERHQKKRPFQCGVCTKSFAFKQGLERHETVHSTNLPFPCQHCERSFSTASKLARHLVAHAG 450

  Fly   633 ERPYECSICEKKFRVSGDLKRHSRIHDPSRTSQPPAEKAKKK-------------RAAASNK--- 681
            :|.|.|..|.|.:.:|..|.||.|.|..:..:.....:.|..             .|.||.|   
  Fly   451 KRAYPCKYCHKSYMLSHHLSRHLRTHTQTSDASFVCSECKVSYSNYNDLLDHALIHATASLKCPM 515

  Fly   682 -QLPIEEDDELATNIQNNK 699
             :..||:.|.:.:::..:|
  Fly   516 CRKQIEDIDSVESHMDQHK 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3407NP_608809.1 COG5048 <494..656 CDD:227381 55/163 (34%)
C2H2 Zn finger 497..517 CDD:275368 6/20 (30%)
zf-H2C2_2 509..534 CDD:290200 9/25 (36%)
C2H2 Zn finger 525..545 CDD:275368 8/20 (40%)
zf-H2C2_2 537..562 CDD:290200 12/25 (48%)
C2H2 Zn finger 555..574 CDD:275371 5/19 (26%)
zf-C2H2 580..602 CDD:278523 7/22 (32%)
C2H2 Zn finger 582..602 CDD:275368 7/20 (35%)
zf-H2C2_2 594..617 CDD:290200 6/23 (26%)
C2H2 Zn finger 610..630 CDD:275368 7/20 (35%)
zf-H2C2_2 622..645 CDD:290200 9/23 (39%)
zf-C2H2 636..658 CDD:278523 9/22 (41%)
C2H2 Zn finger 638..658 CDD:275368 8/20 (40%)
pitaNP_611806.3 zf-AD 17..92 CDD:214871
COG5048 <281..506 CDD:227381 65/226 (29%)
C2H2 Zn finger 288..308 CDD:275368 4/20 (20%)
C2H2 Zn finger 316..336 CDD:275368 6/20 (30%)
zf-H2C2_2 328..353 CDD:290200 9/25 (36%)
C2H2 Zn finger 344..364 CDD:275368 8/20 (40%)
C2H2 Zn finger 372..388 CDD:275370 4/16 (25%)
C2H2 Zn finger 400..420 CDD:275368 7/20 (35%)
C2H2 Zn finger 428..448 CDD:275368 7/20 (35%)
C2H2 Zn finger 456..476 CDD:275368 8/20 (40%)
C2H2 Zn finger 486..506 CDD:275368 1/20 (5%)
HARE-HTH <566..625 CDD:294801
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24390
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.