DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Shaw and KCNQ

Sequence 1:NP_001137782.1 Gene:Shaw FlyBaseID:FBgn0003386 Length:619 Species:Drosophila melanogaster
Sequence 2:NP_788300.3 Gene:KCNQ FlyBaseID:FBgn0033494 Length:993 Species:Drosophila melanogaster

Alignment Length:414 Identity:93/415 (22%)
Similarity:162/415 (39%) Gaps:99/415 (24%)


  Fly   144 KPSEEELARK----FGFEEDYYKGTIS--WWQEMKPRIWSLFDEPYSSNAA-KTIGVVSVFFICI 201
            :|:.|.:.:.    .|...:|.:||..  .::.::.|:::..:.|...:|. ..:.|..:.|.|:
  Fly    24 RPNSERILQPRMSLLGKPLNYNRGTRRDVRYRRLQSRLYNFLERPRGLHAIFYHVMVFLMVFTCL 88

  Fly   202 SILSFCLKTHPDMRVPIVRNITVKTANGSNGWFLDKTQTNAHIAFFYIECVCNAWFTFEILVRFI 266
            ::..|.               |:|           :.:.:|....|.:|.:...|||.|...|..
  Fly    89 ALSVFS---------------TIK-----------EYEEDAVYILFRMEILVVIWFTMEFGARLW 127

  Fly   267 SSP---------NKWEFIKSSVNIIDYIATLSFYIDLVL----QRFASHLENADILEFFSIIRIM 318
            ||.         .:.:|:|....|||.:..|:..:.|.:    |.||:.....  |.||.|:|::
  Fly   128 SSGCRSRYQGCLGRLKFVKRPFCIIDIVTILASIVVLGMGTSGQVFATSALRG--LRFFQILRMV 190

  Fly   319 RLFKLTRHSSGLKILIQTFRASAKELTLLVFFLVLGIVIFASLVYYAERIQPNPHNDFNSIPLGL 383
            |   :.|.....|:|.....|..:||...::...||::..:.|||..|:   :.::.|::....|
  Fly   191 R---MDRRGGTWKLLGSVVYAHRQELITTMYIGFLGLIFASFLVYMWEK---DVNDKFSNFAQAL 249

  Fly   384 WWALVTMTTVGYGDMAPKTYIGMFVGALCALAGVLTIALPVPVIVSNFAMYYSHTQARAKLPKKR 448
            ||.::|:.|||||||.|.|:.|..:.:.|||.|:...|||..::.|.||:.....|.:..:.::|
  Fly   250 WWGVITLCTVGYGDMVPITWQGKLIASCCALLGISFFALPAGILGSGFALKVQQQQRQKHMIRRR 314

  Fly   449 RRVLPVEQP-------------------RQPRLPGAPGGVSGCG--------------------- 473
            :....:.|.                   .:..||..|...:...                     
  Fly   315 QPAATLIQAVWRCYAADEHSVSVATWNIHRVALPSPPASRASSSFKHNTSFVARLPTIRRHKSQT 379

  Fly   474 --TPGSGPHSG---PMGSGGTGPR 492
              |||.|...|   |.||.....|
  Fly   380 IQTPGGGDGGGVSKPPGSSRASTR 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ShawNP_001137782.1 BTB 27..125 CDD:197585
BTB_2 27..117 CDD:280393
Ion_trans 244..439 CDD:278921 62/208 (30%)
Ion_trans_2 355..429 CDD:285168 26/74 (35%)
KCNQNP_788300.3 Ion_trans 100..305 CDD:278921 63/213 (30%)
Ion_trans_2 221..295 CDD:285168 28/77 (36%)
KCNQ_channel <619..719 CDD:281513
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG2126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11537
RoundUp 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.