Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_011537729.1 | Gene: | EGR2 / 1959 | HGNCID: | 3239 | Length: | 489 | Species: | Homo sapiens |
Alignment Length: | 240 | Identity: | 71/240 - (29%) |
---|---|---|---|
Similarity: | 93/240 - (38%) | Gaps: | 61/240 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 171 RPYPAGLHSLHAAVMGRHFGAMPTLKLGG--AG----GASGVPSG--ATGSS------------- 214
Fly 215 ----------RPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHR 267
Fly 268 YIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTK 332
Fly 333 EVVVTTSPATSHSVPNQALSS--PQPENLAQHLPVLDLSSSSSSS 375 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 48/157 (31%) |
C2H2 Zn finger | 222..242 | CDD:275368 | 4/19 (21%) | ||
zf-H2C2_2 | 234..259 | CDD:290200 | 8/26 (31%) | ||
C2H2 Zn finger | 250..270 | CDD:275368 | 7/21 (33%) | ||
zf-H2C2_2 | 262..285 | CDD:290200 | 9/22 (41%) | ||
C2H2 Zn finger | 278..298 | CDD:275368 | 6/19 (32%) | ||
zf-C2H2 | 304..326 | CDD:278523 | 6/21 (29%) | ||
C2H2 Zn finger | 306..326 | CDD:275368 | 6/19 (32%) | ||
EGR2 | XP_011537729.1 | DUF3446 | 107..179 | CDD:403215 | |
zf-C2H2 | 353..377 | CDD:395048 | 8/23 (35%) | ||
C2H2 Zn finger | 355..377 | CDD:275368 | 7/21 (33%) | ||
COG5048 | 381..>449 | CDD:227381 | 23/70 (33%) | ||
C2H2 Zn finger | 385..405 | CDD:275368 | 6/19 (32%) | ||
C2H2 Zn finger | 413..433 | CDD:275368 | 6/19 (32%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.030 |