DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment odd and EGR2

DIOPT Version :9

Sequence 1:NP_722922.1 Gene:odd / 33583 FlyBaseID:FBgn0002985 Length:392 Species:Drosophila melanogaster
Sequence 2:XP_011537729.1 Gene:EGR2 / 1959 HGNCID:3239 Length:489 Species:Homo sapiens


Alignment Length:240 Identity:71/240 - (29%)
Similarity:93/240 - (38%) Gaps:61/240 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 RPYPAGLHSLHAAVMGRHFGAMPTLKLGG--AG----GASGVPSG--ATGSS------------- 214
            :|:|..|.:|...........:....|||  ||    ||||...|  ..|||             
Human   260 KPFPCPLDTLRVPPPLTPLSTIRNFTLGGPSAGVTGPGASGGSEGPRLPGSSSAAAAAAAAAAYN 324

  Fly   215 ----------RPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHR 267
                      ||:     ||.||.          .:|...||||.|  :.|.:.|.|.|.|..|.
Human   325 PHHLPLRPILRPR-----KYPNRP----------SKTPVHERPYPCPAEGCDRRFSRSDELTRHI 374

  Fly   268 YIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTK 332
            .||:..|||:|..|.:.|.:|..|..|..||..|.|..|..|.|.|.:....|.|.:.|..|..:
Human   375 RIHTGHKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDYCGRKFARSDERKRHTKIHLRQKER 439

  Fly   333 EVVVTTSPATSHSVPNQALSS--PQPENLAQHLPVLDLSSSSSSS 375
            :   :::|:.|...|:.|..|  .||..        .|.||:|||
Human   440 K---SSAPSASVPAPSTASCSGGVQPGG--------TLCSSNSSS 473

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
oddNP_722922.1 COG5048 <203..334 CDD:227381 48/157 (31%)
C2H2 Zn finger 222..242 CDD:275368 4/19 (21%)
zf-H2C2_2 234..259 CDD:290200 8/26 (31%)
C2H2 Zn finger 250..270 CDD:275368 7/21 (33%)
zf-H2C2_2 262..285 CDD:290200 9/22 (41%)
C2H2 Zn finger 278..298 CDD:275368 6/19 (32%)
zf-C2H2 304..326 CDD:278523 6/21 (29%)
C2H2 Zn finger 306..326 CDD:275368 6/19 (32%)
EGR2XP_011537729.1 DUF3446 107..179 CDD:403215
zf-C2H2 353..377 CDD:395048 8/23 (35%)
C2H2 Zn finger 355..377 CDD:275368 7/21 (33%)
COG5048 381..>449 CDD:227381 23/70 (33%)
C2H2 Zn finger 385..405 CDD:275368 6/19 (32%)
C2H2 Zn finger 413..433 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2698
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.030

Return to query results.
Submit another query.