| Sequence 1: | NP_722922.1 | Gene: | odd / 33583 | FlyBaseID: | FBgn0002985 | Length: | 392 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011537729.1 | Gene: | EGR2 / 1959 | HGNCID: | 3239 | Length: | 489 | Species: | Homo sapiens |
| Alignment Length: | 240 | Identity: | 71/240 - (29%) |
|---|---|---|---|
| Similarity: | 93/240 - (38%) | Gaps: | 61/240 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 171 RPYPAGLHSLHAAVMGRHFGAMPTLKLGG--AG----GASGVPSG--ATGSS------------- 214
Fly 215 ----------RPKKQFICKYCNRQFTKSYNLLIHERTHTDERPYSC--DICGKAFRRQDHLRDHR 267
Fly 268 YIHSKDKPFKCSDCGKGFCQSRTLAVHKVTHLEEGPHKCPICQRSFNQRANLKSHLQSHSEQSTK 332
Fly 333 EVVVTTSPATSHSVPNQALSS--PQPENLAQHLPVLDLSSSSSSS 375 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| odd | NP_722922.1 | COG5048 | <203..334 | CDD:227381 | 48/157 (31%) |
| C2H2 Zn finger | 222..242 | CDD:275368 | 4/19 (21%) | ||
| zf-H2C2_2 | 234..259 | CDD:290200 | 8/26 (31%) | ||
| C2H2 Zn finger | 250..270 | CDD:275368 | 7/21 (33%) | ||
| zf-H2C2_2 | 262..285 | CDD:290200 | 9/22 (41%) | ||
| C2H2 Zn finger | 278..298 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2 | 304..326 | CDD:278523 | 6/21 (29%) | ||
| C2H2 Zn finger | 306..326 | CDD:275368 | 6/19 (32%) | ||
| EGR2 | XP_011537729.1 | DUF3446 | 107..179 | CDD:403215 | |
| zf-C2H2 | 353..377 | CDD:395048 | 8/23 (35%) | ||
| C2H2 Zn finger | 355..377 | CDD:275368 | 7/21 (33%) | ||
| COG5048 | 381..>449 | CDD:227381 | 23/70 (33%) | ||
| C2H2 Zn finger | 385..405 | CDD:275368 | 6/19 (32%) | ||
| C2H2 Zn finger | 413..433 | CDD:275368 | 6/19 (32%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2698 |
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.030 | |||||