DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spindly and Spdl1

Sequence 1:NP_608791.2 Gene:Spindly FlyBaseID:FBgn0031549 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_081687.2 Gene:Spdl1 MGIID:1917635 Length:608 Species:Mus musculus

Alignment Length:648 Identity:158/649 (24%)
Similarity:263/649 (41%) Gaps:164/649 (25%)


  Fly    12 VDDIVEEYKLLHDRHQQLKDQSEKDA-QRIYELKRNLDTALAAE-SYLTQ----ELEHLSSQPVA 70
            :|...||..:..:::.|     ||.| ||..|||..:..:|:.| ..|.|    :||.|..|   
Mouse    40 LDKCHEEMMITAEKYNQ-----EKHALQREVELKSRMLDSLSCECEALKQQQKAQLEQLEVQ--- 96

  Fly    71 IASGGNGQELEELRRKFKTLKEEQDVLQQDYDAKVEETRSLKDKLTAAEKNLAEKSAS----RSN 131
             ....:.||:.:|:.|.:.||.|.|      :|::.| :.||.||....:.||.||..    ...
Mouse    97 -LHRSHRQEVSDLKNKLENLKVELD------EARLGE-KQLKQKLDLQGELLAHKSEELRLLSEQ 153

  Fly   132 QLHDDFFARLNALELENCELLQKLAEYEDLRIANTLAVAEKEKTIECLQDRVSCMEQNLNCKRDE 196
            ::.....:.|.|||.|       |...|.::    .|:.|:...::..|:::.|:..:|..:.|.
Mouse   154 RVLSSMSSELLALETE-------LTAAEGVK----NALKEEVNELQYKQEQLECLNTSLLHQVDR 207

  Fly   197 LEEKLQ-----------LLESCQEQLVDANAKI--ALLTSAPENNDRKGNSLFAEVDDQRQAMKQ 248
            |:|:.:           .||..:.:..|...::  ||..:|..|:  |||||||||:|:|.||::
Mouse   208 LKEEKEEREREAVSYYNALEKARVENQDLQVQLGHALQQAADPNS--KGNSLFAEVEDRRVAMER 270

  Fly   249 ILAAQKKSYLDMKK--IFTDSQFEIRRLKRENV----AMHTELQACSTIFCSADKTYQNKLNERI 307
            .|...|..|..:||  .||..|....:|:...:    ...||.:....:|...::.     |..|
Mouse   271 QLNLMKDKYQSLKKQNAFTRDQMNKMKLQISTLLRMRGSQTEFEQQERLFAMIEQK-----NGEI 330

  Fly   308 RQLMTANDSLERQLNLSQE-RLRQLASEKSVTWLDS---------MLDFCKRETDELKAQLHSMR 362
            :.|:...:.||:..||.:. ..|...|:.:....||         .||...:|.:..|.:|...|
Mouse   331 KHLLGEINKLEKFKNLYESMESRPSTSDTACVLEDSTYYSDLLQLKLDKLNKENESTKDELSIQR 395

  Fly   363 IQKAGLEERMRCVQQEMARWRFESLKSRCVLIDRENL-----LAEHKIVFKPMQAMEFNIKEAEL 422
            ::  .|.|..|.:..|...:..|   ....|.:.||:     |.|.|:.::|.:.:|..:.:.. 
Mouse   396 MK--ALFESQRALDIERKLFTNE---RHLQLSESENMKLRAKLDELKLKYEPEERIEVPVLKRR- 454

  Fly   423 KTALPRIVSVAAQSPSSSAQLHTHPETSLKSAAETTSKSFPTATEIIVLDAPLKPAIKEEVVEPL 487
            :..||..:              |.||       ||...:..:|||..|  :.|.|..:||     
Mouse   455 REVLPLNI--------------TTPE-------ETEETAAASATEDGV--SRLPPHREEE----- 491

  Fly   488 SQELKPALKDTSVKVEQELEVSESKACIK---RTPIKTIMGMKIKREIDLNLEQQDAVDIKKELE 549
              ....:|||.:|:.:|     .:.:|::   .:|.|           :|:|:.|.    |||.:
Mouse   492 --SCLNSLKDNTVQWKQ-----PASSCVQPASLSPHK-----------NLHLDTQP----KKEKK 534

  Fly   550 APELIPKPQLKGTPVKAKNDGVTPQMNIQEDENEETGLNSVETPAKPLMKG-----TPVKQRL 607
            ..:|:..|                 .|| |..:|::|    .||..|.:..     |.||:|:
Mouse   535 CVKLVDSP-----------------ANI-EVLHEQSG----NTPNSPRLTAESKLPTEVKERI 575

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SpindlyNP_608791.2 Smc <11..336 CDD:224117 94/354 (27%)
Spdl1NP_081687.2 Exonuc_VII_L <83..157 CDD:280721 23/85 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.970

Return to query results.
Submit another query.