DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spindly and spdl1

Sequence 1:NP_608791.2 Gene:Spindly FlyBaseID:FBgn0031549 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_021336729.1 Gene:spdl1 ZFINID:ZDB-GENE-070928-7 Length:596 Species:Danio rerio

Alignment Length:664 Identity:153/665 (23%)
Similarity:271/665 (41%) Gaps:171/665 (26%)


  Fly    15 IVEEYKLLHDRHQQLK----------DQSEKDAQRIYELKRNLDTALAAESYL--TQELEHLSSQ 67
            :::|...||:|.::.:          :|.:...||..|||..:..:|.:|..|  ||: :|...|
Zfish    38 LLDEKMELHNRLEEQRTEMSNVIEALEQDKYSLQREVELKIRMLESLRSEFDLVRTQQ-KHQMEQ 101

  Fly    68 PVAIASGGNGQELEELRRKFKTLKEEQDVLQQDYDAKVEETRSLKDKLTAAEKNL---AEKSASR 129
            ...:....:..|:.:|:.|...:..:.|      :|::.| :.::.||....:.|   .|:..:.
Zfish   102 QQTLLERNHAVEISDLKNKVVKMNTDLD------EAQLAE-KQMRHKLNQQAEALNSKTEELRAL 159

  Fly   130 SNQLHDDFFARLNALELENCEL----------LQKLAEYED--LRIANTLAVAEKEKTIECLQDR 182
            :.:.|:...:.:..|:::..||          ||: |:|:|  |.:|||....:.|:..|..::|
Zfish   160 TERAHETMSSEILELQVQKMELESAMATLEQELQE-AQYKDEQLHLANTTLQRQLERLTEEKEER 223

  Fly   183 ----VSCMEQNLNCKRDELEEKLQL-LESCQEQLVDANAKIALLTSAPENNDRKGNSLFAEVDDQ 242
                |||  .|...|..|..:.||: ||...:|..|.|:              ||||||:||:|:
Zfish   224 EKEAVSC--YNALEKAREANQDLQIQLEQVLQQAQDPNS--------------KGNSLFSEVEDK 272

  Fly   243 RQAMKQILAAQKKSYLDMKKIFTDSQFEIRRLKRE---------NVAMHTELQACSTIFCSADKT 298
            |.||::.|.:.|::|..::|....::..:..:|.:         |.|...:|:...  |..:|| 
Zfish   273 RAAMERQLNSMKRNYESLQKQHVLTKQHMHHMKMQIATLMQLQGNRADPAQLERLQ--FMLSDK- 334

  Fly   299 YQNKLNERIRQLMTANDSLERQ-LNLSQERLRQLASE---KSVTWLDSMLDF----CKRETDELK 355
                 |:.|..||.....||:: :.:........::|   |..|:...:|..    .|::.::||
Zfish   335 -----NKEIESLMMKVRELEKEKMAVKDHHPHPPSNEGELKDETYYTDLLKMQLANSKKDAEKLK 394

  Fly   356 AQLHSMRIQKAGLEERMRCVQQEMARWRFE-SLKSRCVLIDRENL-----LAEHKIVFKPMQAME 414
            .:| ||...|| |.|..|.::.|...:..| :||.|    ..:|:     |.|.||.:.|.:..:
Zfish   395 EEL-SMARMKA-LSESQRVLELERKLYGTEQALKLR----HSDNMKLQVKLEELKIKYTPNEVNK 453

  Fly   415 FNI-KEAELKTALPRIVSVAAQSPSSSAQLHTHPETSLKSAAETTSKSFPTATEIIVLDAPLKPA 478
            ..: |....|..:|...|.:.:..:::..  |.|..:....||..:.|.|....:::      |.
Zfish   454 AQVQKRRREKFPVPEENSASVKDETTTQD--TEPSKNSNEKAEEKNPSHPVEKPVVI------PL 510

  Fly   479 IKEEVVEP---LSQELKPALKDTSVKVEQELEVSESKACI---KRTPIKTIMGMKIKREIDLNLE 537
            ..|:..||   ||:|.|      ||::.::..|     ||   .|:|:.           |.|  
Zfish   511 QSEQPTEPNPVLSRESK------SVRICEDPPV-----CIPDAPRSPVN-----------DSN-- 551

  Fly   538 QQDAVDIKKELEAPELIPKPQLKGTPVKAKNDGVTPQMNIQEDENEETGLNSVETPAKPLMKGTP 602
                                        :||...|.|.: :|:||..|     |...|...:.|.
Zfish   552 ----------------------------SKNVDQTHQSS-EEEENWRT-----EKKRKKYQQPTH 582

  Fly   603 VKQRLGGIKVKSNE 616
            |..:    |..:||
Zfish   583 VSSQ----KTMANE 592

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SpindlyNP_608791.2 Smc <11..336 CDD:224117 87/366 (24%)
spdl1XP_021336729.1 SMC_N <9..350 CDD:330553 85/345 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
10.960

Return to query results.
Submit another query.