DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spindly and spdl1

Sequence 1:NP_608791.2 Gene:Spindly FlyBaseID:FBgn0031549 Length:781 Species:Drosophila melanogaster
Sequence 2:NP_001123745.1 Gene:spdl1 XenbaseID:XB-GENE-5754925 Length:611 Species:Xenopus tropicalis

Alignment Length:681 Identity:147/682 (22%)
Similarity:254/682 (37%) Gaps:190/682 (28%)


  Fly    22 LHDRHQQLKDQSEKDAQRIYELKRNLDTALAAESYLTQELEHLSSQPVAI-------ASGGNGQE 79
            |.::..::....|...|..|.|:|.::........||.|.|::..|....       ....:.:|
 Frog    42 LEEQRNEMTSTIENLEQEKYSLQREVELKNRMLESLTSECENIRQQQKLCLEQLQEQLERNHHRE 106

  Fly    80 LEELRRKFKTLKEEQDVLQQDYDAKVEETRSLKDKLTAAEKNLAEKSAS---RSNQLHDDFFARL 141
            |.|::.|.:.||.|.|      :|::.| :.||.||....:.||.||..   .|.::|:...:.:
 Frog   107 LSEIKDKLEKLKAELD------EARLSE-KQLKHKLEYQSEVLANKSEELRMMSERVHETMSSEM 164

  Fly   142 NALELENCELLQKLAEYEDLRIANTLAVAEKE---------KTIECLQDRVSCMEQNLNCKRDEL 197
            ..|:||..||....|..|  :..|.|...|::         :.:|.|||.          |.|..
 Frog   165 LTLQLEKTELESAKANLE--QEVNELQYREQQLLLTNGTQSRQLERLQDE----------KEDRE 217

  Fly   198 EEKL---QLLESCQEQLVDANAKIALLTSAPENNDRKGNSLFAEVDDQRQAMKQILAAQKKSYLD 259
            :|.:   :.||..:|...|..|::.:.....::.:.|||||||||:|:|..|::.|.:.|..:..
 Frog   218 KEAVGYFKALEKAREANQDLQAQLDIALQQAQDPNSKGNSLFAEVEDRRAEMERQLISMKVQFQS 282

  Fly   260 MKKIFTDSQFEIRRLKRENVAMHTELQACSTIFCSADKTYQNKLNERIRQLMTANDSLERQLNLS 324
            ::|....|:.::.|:|   |.:.|.||                        :..:.|...||   
 Frog   283 LQKQHAFSRQQMHRMK---VQIATLLQ------------------------LKGSQSDPEQL--- 317

  Fly   325 QERLRQLASEKS---------VTWLDSMLDFCKR--------------ET---DELKAQL--HSM 361
             |||:.:.::|:         |..|:.....|:.              ||   |.||.:|  .|.
 Frog   318 -ERLQAMVAQKNSEFETLVMKVRQLEKSQQICENGPVANSSDGLGQGDETYYVDLLKMKLVNSSK 381

  Fly   362 RIQKAGLEERMRCVQQEMARWRFESLKSRCVLIDRENLLAEHKIVFKPMQA----MEFNIKEAEL 422
            .|:|         ::.|::..|.::|.....::|.|..|..:....|..|.    :..|:.|.::
 Frog   382 EIEK---------IKDELSLQRMKALAESQRVLDLERKLFANDRHLKLSQGENMKLRVNLDEMKM 437

  Fly   423 KTALPRIVSVAAQSPSSSAQLHTH----PETSLKSAAETTSKSFPTATEIIVLDAPLKPAIKEEV 483
            |           ..|...|::.|.    .:..|..|.:.||.:..:.::.    ..|..||.|::
 Frog   438 K-----------YEPDEIAKIRTQKRRKEQLPLDCAIDNTSATVTSGSQA----HGLSDAIPEDM 487

  Fly   484 VEPLSQELKPALKDTSVKVEQELEVSESKACIKRTPIKTIMGMKIKREIDLNLEQQDAVDIKKEL 548
            .        ||               ||          |:....:|.:..|:.::||       |
 Frog   488 C--------PA---------------ES----------TVHRNLLKEDSSLSTKEQD-------L 512

  Fly   549 EAPELIPKPQLKGTPVKAKNDGVTPQMNIQEDENEETGLNSVET---------PAKPLMKGTPVK 604
            .:..:.|.....|.|.|.:.     ::.|.|:||:...:|...|         |.....:.|...
 Frog   513 SSVAVKPIEPANGQPPKERK-----RVRIVENENDNQDINKRNTNNCSVTSTSPRSASEESTSES 572

  Fly   605 QRLGGIKVKSNEELLGARL---PGTVTPAKP 632
            :|....:.|..:| ..:||   |....|:||
 Frog   573 KRFDEEQEKRKQE-RKSRLRAPPVLHVPSKP 602

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SpindlyNP_608791.2 Smc <11..336 CDD:224117 82/336 (24%)
spdl1NP_001123745.1 CDC37_N <39..136 CDD:296150 25/101 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
21.970

Return to query results.
Submit another query.