DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3246 and CG13618

Sequence 1:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_651265.1 Gene:CG13618 FlyBaseID:FBgn0039203 Length:252 Species:Drosophila melanogaster

Alignment Length:258 Identity:60/259 (23%)
Similarity:95/259 (37%) Gaps:78/259 (30%)


  Fly    49 IAAQVEAMLVHFQQEDPQGLP------------------------------GVPVPDPLEVPNVK 83
            |||..:.:.|...||.|:|.|                              |:|..:||.|..:.
  Fly    13 IAAVAQELTVTAAQELPEGFPKCKRDANFDKCLVDAVNVAIQQLKAGNREFGIPPLEPLTVKKLV 77

  Fly    84 KSMGMANLDMKQ----VKAYG-LSKFRIDKMNLDLKEMRFNGGLQLDQMLVKGQYTLS------- 136
            ...|.|.::::|    ||.:. :|..:|.:...||.:.......:.|::.:.|.|.:|       
  Fly    78 IDAGNAPINLRQALKNVKVHDMISTSKIQRYRTDLDKHLIICDSRTDRIEMIGDYEMSGRILLLP 142

  Fly   137 -SFFSKANGPFTVVLKNVYAE----ATAFLAVERDG----QLATDRIKIDITFSDMTMDFQNLGL 192
             :...|||    |.|.|...|    ...|   |:||    :|...|:..|.  ..:.|:|:||  
  Fly   143 ITGHGKAN----VTLINTKIEHRLIGEPF---EKDGVKYMRLKDYRVSFDP--KRVYMNFENL-- 196

  Fly   193 VGSVFQSVVNGAPNLVFDAMKPFMLQEADKKLRSEINVMIQKTLG--ERRLPNSI---TPLDS 250
                |..      ..:.|.|..| |.|..:.:.:|:.|...|:.|  .|.|.|.:   .|.|:
  Fly   197 ----FND------KTLSDGMNRF-LNENWETVFNELKVGYAKSFGIIFRELSNKLFEKVPFDN 248

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 58/253 (23%)
Grp7_allergen 260..418 CDD:293589
CG13618NP_651265.1 JHBP 13..251 CDD:284096 60/259 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403246
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.