DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3246 and CG7079

Sequence 1:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001287436.1 Gene:CG7079 FlyBaseID:FBgn0038849 Length:255 Species:Drosophila melanogaster

Alignment Length:68 Identity:15/69 (22%)
Similarity:29/69 (42%) Gaps:7/69 (10%)


  Fly   248 LDSAIAMAR---KMVRQKGFDPYHLPDVNRTMGVFSVQLAHTWINGISSFYRVGNITAGMANKTV 309
            ::||.|:.|   |.:.:....|:::..|...:.|...|:...|.    .|..:..|..|..|.|:
  Fly    38 VESANALLRDFPKGIPEVDLKPFNVLSVRDWLLVNDSQVGGAWY----YFNLINQINYGFENTTI 98

  Fly   310 SVV 312
            :.:
  Fly    99 TEI 101

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779
Grp7_allergen 260..418 CDD:293589 10/54 (19%)
CG7079NP_001287436.1 JHBP 20..249 CDD:214779 15/69 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403093
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.