DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3246 and CG14457

Sequence 1:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001014600.1 Gene:CG14457 FlyBaseID:FBgn0037174 Length:271 Species:Drosophila melanogaster

Alignment Length:173 Identity:32/174 (18%)
Similarity:63/174 (36%) Gaps:32/174 (18%)


  Fly    67 GLPG---VPVPDPLEVPNVKKSMGMAN-----LDMKQVKAYGLSKFRIDKMNLDLKEMRFNGGLQ 123
            |:||   :...||..:..::.:.|.:|     :::..||..|.....:....:..|:..:.....
  Fly    60 GIPGLTSIRSFDPFYLNRIRITQGNSNAINLKVELANVKIIGFGHTNVLDSQVFKKDYSWKTTFT 124

  Fly   124 LDQMLVKGQYTLSSFFSKANGPFTVVLKNVYAEATAFLAVERDGQLATDRIKIDITFSDMTMDFQ 188
            |.:|.::..|:|          |..:|         .:.:...||:..|...:.:|....|..:.
  Fly   125 LPEMKLQADYSL----------FGRIL---------LIPLNGKGQVFLDAENMTVTMHTKTRLYS 170

  Fly   189 NLGLVGSVFQSVVNGAPNLVFDAMKPFM--LQEADKKLRSEIN 229
            ..|.   .|.:|.|...:...|.:|.:.  |...:|:|....|
  Fly   171 KGGF---TFYNVTNLHVDFKMDGLKSYFSNLFNGNKQLEDSTN 210

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 32/174 (18%)
Grp7_allergen 260..418 CDD:293589
CG14457NP_001014600.1 JHBP 6..253 CDD:284096 32/174 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403055
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.