DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3246 and CG33680

Sequence 1:NP_608781.2 Gene:CG3246 FlyBaseID:FBgn0031538 Length:445 Species:Drosophila melanogaster
Sequence 2:NP_001027448.1 Gene:CG33680 FlyBaseID:FBgn0053680 Length:278 Species:Drosophila melanogaster

Alignment Length:213 Identity:52/214 (24%)
Similarity:82/214 (38%) Gaps:81/214 (38%)


  Fly    50 AAQVEAMLVHFQQEDPQGLPGVPVPDPLEVPNVKKSMGMANLDMKQVKAYGLSKFRIDKMNLDLK 114
            |.|:..:|||....|  |.|..|: :||.:.|::..:.              |:|:     ...|
  Fly    53 AYQIRPLLVHGNLGD--GFPTSPL-EPLSLDNIELKLS--------------SQFQ-----AVFK 95

  Fly   115 EMRFNGG-------LQLDQML--VKGQYTLSSFFSKANGPFTVVLKNVYAEATAFLAVE-----R 165
            ::..|||       |.|:.:|  :||:..:..:...|.               ||:.:.     |
  Fly    96 DLEANGGNYTGKYSLHLNLLLPDIKGKGNMQGYCENAK---------------AFVKIRGSRYLR 145

  Fly   166 DGQLATDRIKIDITFSDMT--MDFQNLGL-----------VGSVFQSVVNG---------APNLV 208
            :|:   |.:|    ||.||  :||::..|           :|.|..|::|.         ||:|.
  Fly   146 NGK---DYVK----FSKMTTLIDFKDFKLKLANLFSGDRFLGDVGNSLINNNQELYLKDIAPSLE 203

  Fly   209 FDAMKPFMLQEADKKLRS 226
            ....|.| |..|||.|.|
  Fly   204 HGLSKHF-LDVADKILAS 220

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3246NP_608781.2 JHBP 31..246 CDD:214779 52/214 (24%)
Grp7_allergen 260..418 CDD:293589
CG33680NP_001027448.1 JHBP 31..228 CDD:284096 52/214 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C1403516
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11008
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.