DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: p120ctn and pkp4

Sequence 1:NP_001036444.1 Gene:p120ctn FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_012826046.1 Gene:pkp4 XenbaseID:XB-GENE-489870 Length:1195 Species:Xenopus tropicalis

Alignment Length:788 Identity:300/789 (38%)
Similarity:422/789 (53%) Gaps:118/789 (15%)


  Fly     8 HSLIGLN----MNSTHINMDLSLTHEPANMQSQFGSFQNYDQFSAAGYSSTPLY----ITKPTGV 64
            ||.:|.:    |.|:.......:|..|.:|.:...:..:.||:   |.....:|    ..:|..:
 Frog   325 HSRVGSSSQTPMGSSSSPKRAGMTAVPQHMGTLQRNLHDIDQY---GQQHFDIYERMVPPRPDSL 386

  Fly    65 -GAITKVAPHCSQNKIETNSTDNSIPDIENHPLATTVRYVQAGQYEDTSEYGVA---GLTCGIDS 125
             |..:..|...||...|..|..:  ||::..|:           ||..:.|...   .....|:.
 Frog   387 TGLRSSYASQHSQLGQELRSAVS--PDLQITPI-----------YEGRTYYSPVYRNANHAAIEL 438

  Fly   126 EYTAEAVVPYCYTSDANYTGIQNTTSSIKPFSGRPFNDNINGAEAVADSQCRTFKSSAEFKLPQF 190
            ...:...:   |.:.:..:.:|.|.|.....:.:..|..:|.|...|:          .::..|:
 Frog   439 RQGSNTAI---YRTGSGSSNLQRTMSQRSTLAYQRNNYALNSAANYAE----------PYRSMQY 490

  Fly   191 AMS--SINTVPQRLEEKD--------DYIEGSENDICSTMRWRDPNLSEVISFLSNPSSAIKANA 245
            .:|  ..|.:|......|        |.|:....:..    ||||.|.|||..|.:...:::|||
 Frog   491 RISEPGYNRMPHSAPPDDGTTRSPSIDSIQKDPREFA----WRDPELPEVIHMLQHHFPSVQANA 551

  Fly   246 AAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNA 310
            ||||||||:.|...|.....||||..||.||.....|:.||||||||||.||:..||||..:|||
 Frog   552 AAYLQHLCFGDHKTKIEVCRLGGIKHLVDLLDNKVLEVQKNACGALRNLVYGKSTDENKVAVKNA 616

  Fly   311 GGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGWDAVCCGE 375
            ||:.||:.||.::.:.||:|||||||||:|||:.:|.:||.:||..:..:||.||||::     .
 Frog   617 GGVPALLRLLRKTNDQEVRELVTGVLWNLSSCDAVKMTIIRDALSPLTNTVIVPHSGFN-----N 676

  Fly   376 TCF----------STVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKT 430
            :.|          |:|.||.:|.:||:|||||.||..:|.||.||:.||:|::|.:..::..:||
 Frog   677 SSFDDDHKMKFQSSSVLRNTTGCMRNLSSAGEEARKQMRYCEGLVDSLLFVIQTCVNTSDFDSKT 741

  Fly   431 VENCVCILRNLSYRCQEVDDPNYDKHPFITPERVI----------PSSSKGENLGCFG-TNKKKK 484
            ||||||.|||||||. |::.|.         .|::          .|.||..:..|:| ..||||
 Frog   742 VENCVCTLRNLSYRL-ELEVPQ---------ARMLGINEMDGFCKESPSKESDSSCWGKKKKKKK 796

  Fly   485 EANNSDALNEYNISADYSKSSVTYNKLNKGYEQLWQPEVVQYYLSLLQSCSNPETLEAAAGAIQN 549
            :....|..:........|:|.       ||.|.||.|.||:.||:||...|||.|||.:||::||
 Frog   797 KPPQEDLWDGVGPIPGLSQSP-------KGVEMLWHPSVVKPYLTLLAESSNPATLEGSAGSLQN 854

  Fly   550 LSACYWQPSIDIRATVRKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDL 614
            |||..|:.:..|||.||||||||||||||||:.||||.:|||||||:|:|.||||||||||||||
 Frog   855 LSAGNWKFAAYIRAAVRKEKGLPILVELLRMDNDRVVSSVATALRNMALDVRNKELIGKYAMRDL 919

  Fly   615 VQKLPSGN---VQHDQNTSDDTITAVLATINEVIKKNPEFSRSLLDSGGIDRLMNITKRKEKYTS 676
            |.:||.||   |     .||||:.|:...::||..||.|.:::|.|:|||::|:||||.|...:|
 Frog   920 VNRLPGGNGPCV-----LSDDTVAAICCALHEVTSKNMENAKALADTGGIEKLVNITKGKGDRSS 979

  Fly   677 C-VLKFASQVLYTMWQHNELRDVYKKNGWKEQDFVS-------KHFTAHNTPPSSPNNVNNTLNR 733
            . |:|.|:|||.|:||:.:||.:|||:||.:..|::       :.|.:|    .|.:..|..::.
 Frog   980 LKVVKAAAQVLNTLWQYRDLRSIYKKDGWNQSHFITPVSTLERERFKSH----PSLSTTNQQMSP 1040

  Fly   734 PMASQGRT 741
            .:.|.|.|
 Frog  1041 MIQSVGST 1048

Known Domains:


GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 64/114 (56%)
armadillo repeat 227..252 CDD:293788 14/25 (56%)
armadillo repeat 260..296 CDD:293788 20/36 (56%)
armadillo repeat 304..339 CDD:293788 21/35 (60%)
ARM 307..442 CDD:237987 70/145 (48%)
armadillo repeat 347..392 CDD:293788 18/55 (33%)
armadillo repeat 515..556 CDD:293788 24/41 (59%)
ARM 516..643 CDD:237987 81/130 (62%)
armadillo repeat 562..596 CDD:293788 29/34 (85%)
armadillo repeat 601..641 CDD:293788 25/43 (58%)
pkp4XP_012826046.1 ARM 525..647 CDD:237987 68/126 (54%)
HEAT_2 533..636 CDD:290374 54/103 (52%)
armadillo repeat 533..558 CDD:293788 14/25 (56%)
armadillo repeat 566..602 CDD:293788 20/36 (56%)
armadillo repeat 610..645 CDD:293788 21/35 (60%)
armadillo repeat 652..703 CDD:293788 19/56 (34%)
ARM 683..>770 CDD:237987 41/97 (42%)
armadillo repeat 711..752 CDD:293788 21/41 (51%)
armadillo repeat 820..857 CDD:293788 22/37 (59%)
ARM 821..949 CDD:237987 83/133 (62%)
armadillo repeat 869..901 CDD:293788 27/32 (84%)
armadillo repeat 908..949 CDD:293788 25/46 (54%)
armadillo repeat 955..990 CDD:293788 17/35 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125744at33208
OrthoFinder 1 1.000 FOG0001053
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.