DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: p120ctn and pkp1

Sequence 1:NP_001036444.1 Gene:p120ctn FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_012809816.1 Gene:pkp1 XenbaseID:XB-GENE-949309 Length:753 Species:Xenopus tropicalis

Alignment Length:751 Identity:194/752 (26%)
Similarity:312/752 (41%) Gaps:137/752 (18%)


  Fly    11 IGLNMNSTHINMDLSLTHEPANMQSQFGSF---QNYDQFSAAGYSSTPLYITKPTGVGAITKVAP 72
            ||...|.| :..|          |.:|.|:   .|:.|.....|:| ||              :|
 Frog    97 IGYQYNGT-LKRD----------QQRFSSYSQADNWGQHRHMSYAS-PL--------------SP 135

  Fly    73 HCSQNKIETNSTDNSIPDIENHPLATTVR----YVQ----------AGQYEDTSEYGVAGL---- 119
            ....:..:|..:..|.||:....:..|:|    |.|          .|:..::|.|.....    
 Frog   136 GSDFDYKQTLKSSRSEPDLTGPDVRATLRRQNQYNQMQNQHHQQQRPGRAHNSSFYSYHSTQQKK 200

  Fly   120 -----------TCGIDSEYTAEAVVPYCYTSDANYTGIQNTTSSIKPFSGRPFNDNINGAEAVAD 173
                       :.....:...:....:||     ||..|...|:.:.|: .|..||         
 Frog   201 RGPMTPARTPSSLSTVQQQQQQQQQQHCY-----YTNAQRNESNFQNFN-IPKQDN--------- 250

  Fly   174 SQCRTFKSSAEFKLPQFAMSSINTVPQRLEEKDDYIEGSENDICSTMRWRDPNLSEVISFLSNPS 238
                              ..:|| ||.|::.:|::..|.            ..|...:..|..|.
 Frog   251 ------------------YGTIN-VPSRMDTRDEFDAGG------------MTLDRAVELLGYPD 284

  Fly   239 SAIKANAAAYLQHLCYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDEN 303
            ...:.:.|.|:||.|:.|:..|.......||..|:.||...:..:.:...||||||.:  :|..|
 Frog   285 DKFQMSGANYIQHACFQDENAKNLVYQSNGISKLINLLQSPNENVQQATAGALRNLVF--KNSAN 347

  Fly   304 KRGIKNAGGIAALVHLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHSGW 368
            |......||....|.||.|:...::::.:||:|||:||.:.||..::.|||..:...|:.|:|||
 Frog   348 KLETSQKGGTREAVSLLKRTSHPDIQKQLTGLLWNLSSSDQLKDELVKEALPVLNERVVIPYSGW 412

  Fly   369 -DAVCCGETCF--STVFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKT 430
             :.....:.|.  ..||.||:|.|||:||| :..|..:|||..||:.|::.::..:......:|:
 Frog   413 SERSMSNQNCMLDPEVFFNATGCLRNLSSA-DVGRKAMRNCPGLVDSLMFYIQKCLANKCPDDKS 476

  Fly   431 VENCVCILRNLSYRCQEVDDPNYDKHPFITPERVIPSSSKGENLGCFGTNKKKKEANNSDALNEY 495
            ||||.|||.||||.. :.:.||  |:..:..:......:.....||| :||.:|..||:..|...
 Frog   477 VENCACILHNLSYHL-DSEVPN--KYSQLDEQMYRLQQNDKTTTGCF-SNKSEKLQNNNFQLPLP 537

  Fly   496 NISADYSKSSVTYNKLNKGYEQLWQPEVVQYYLSLLQSCSNPETLEAAAGAIQNLSACYWQPSID 560
            ...|:           .||...|.....::.|||||:......||||.|||:|||:|...|.|..
 Frog   538 EEDAN-----------PKGAALLSHSSAIRTYLSLLEQSKKDSTLEACAGALQNLTASKGQMSNG 591

  Fly   561 IRATV-RKEKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKL--PSGN 622
            :...: .|:||:|.:..||:.....||.|.::.|.|::......:.:...|:.|:.:.|  .||.
 Frog   592 MSQIIGLKDKGIPQITRLLQSGNADVVKAGSSLLSNMSRHPSLHKTMATQALPDVSRILSQSSGK 656

  Fly   623 VQHDQNTSDDTITAVLATINEVIKKNPEFSRSLLDSGGIDRLMNITKRKEKYTSCVLKFASQVLY 687
            ..:    |:|.:::...|:..:....|:.::..:....:..|:|:.|   ...|..:..|::|..
 Frog   657 TMN----SEDILSSACYTMRNLAMAEPQIAKQNISGNLLGNLVNMCK---SGASPKVGEAARVFL 714

  Fly   688 T-MWQHNELRDVYKKNGWKEQDFVSKHFTA-HNTPP 721
            | ||...||:...|:.|..:....|...|| .||.|
 Frog   715 TDMWAQRELQGFLKQQGLDKSIMGSLASTALRNTIP 750

Known Domains:


GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 36/114 (32%)
armadillo repeat 227..252 CDD:293788 7/25 (28%)
armadillo repeat 260..296 CDD:293788 12/36 (33%)
armadillo repeat 304..339 CDD:293788 12/35 (34%)
ARM 307..442 CDD:237987 52/138 (38%)
armadillo repeat 347..392 CDD:293788 17/48 (35%)
armadillo repeat 515..556 CDD:293788 17/41 (41%)
ARM 516..643 CDD:237987 38/130 (29%)
armadillo repeat 562..596 CDD:293788 11/35 (31%)
armadillo repeat 601..641 CDD:293788 8/42 (19%)
pkp1XP_012809816.1 ARM 271..385 CDD:237987 36/116 (31%)
armadillo repeat 273..298 CDD:293788 7/25 (28%)
Syo1_like 301..>506 CDD:240521 73/211 (35%)
armadillo repeat 306..342 CDD:293788 12/36 (33%)
armadillo repeat 348..383 CDD:293788 12/35 (34%)
armadillo repeat 391..439 CDD:293788 17/48 (35%)
ARM 547..675 CDD:237987 38/132 (29%)
armadillo repeat 555..581 CDD:293788 14/26 (54%)
armadillo repeat 595..630 CDD:293788 11/35 (31%)
armadillo repeat 636..674 CDD:293788 8/42 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87446042
eggNOG 1 0.900 E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
32.790

Return to query results.
Submit another query.