DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: p120ctn and pkp3b

Sequence 1:NP_001036444.1 Gene:p120ctn FlyBaseID:FBgn0260799 Length:781 Species:Drosophila melanogaster
Sequence 2:XP_002662884.1 Gene:pkp3b ZFINID:ZDB-GENE-130530-870 Length:791 Species:Danio rerio

Alignment Length:729 Identity:198/730 (27%)
Similarity:330/730 (45%) Gaps:98/730 (13%)


  Fly    35 SQF-GSFQNYDQFSAAGYSSTPLYITKPTGVGAITKVAPHCSQNKIETNSTDNSIPDIENHPLAT 98
            ||: |.|.:.............|.:..|..||     .|:...:....:|:.|.:...|:..|:.
Zfish   102 SQYAGDFSSRSAVETGTRHRISLGVPMPAVVG-----RPYTYHDDAHLSSSYNQMQTSESRTLSR 161

  Fly    99 TVRYVQAGQYEDTSEYGVAGLTCGIDSEYTAEAVVPYCYTSDANYTGIQNTTSSIKPFSGRPFN- 162
            |.:.|.|          :||||...........:..|..:...|....|.|.|......|  || 
Zfish   162 TEQEVAA----------MAGLTLQRQPSPVGNWMPNYGQSPSPNTAHRQRTLSGTLAREG--FNT 214

  Fly   163 ---------------------DNINGAEAVADSQCRTFKSSAEFKLPQF---------------- 190
                                 ..||..:.......|...||.:::....                
Zfish   215 GWREAELANQYAFKGPSHRTISRINNRQVQQQQHQRLSGSSMQWQQMSTGGNSLMGAGHYQGTIK 279

  Fly   191 ---AMSSINTVPQRLEEKDDYIEGSENDICSTMRWRDPNLSEVISFLSNPSSAIKANAAAYLQHL 252
               ::.|:.:|.:.::..|...:|:.:.:...   .:.:::..:|:||:...:::...|||:||.
Zfish   280 RAGSVHSMKSVGRGVDVYDGLADGTADGLGGI---HNLDMTTAVSYLSSTDVSMQMLGAAYVQHQ 341

  Fly   253 CYMDDPNKQRTRSLGGIPPLVRLLSYDSPEIHKNACGALRNLSYGRQNDENKRGIKNAGGIAALV 317
            ||..:..|...|||.||..||:|.|.::.|:.:.|.||.|||.|  :|.:||..:..||||:.|:
Zfish   342 CYHSNEAKTMVRSLKGISALVQLFSSENQEVQRYATGATRNLIY--ENMDNKTALIEAGGISKLI 404

  Fly   318 HLLCRSQETEVKELVTGVLWNMSSCEDLKRSIIDEALVAVVCSVIKPHS-GWDA-VCCGETCFST 380
            ..| |..:.|:::.:||:|||:||.:.||..:..|:|..:...|:.|.| |.|| |.......:.
Zfish   405 GAL-REPDDELRKNITGILWNLSSKDSLKERLARESLAELTERVLVPLSGGGDAGVIQQSASEAD 468

  Fly   381 VFRNASGVLRNVSSAGEHARGCLRNCEHLVECLLYVVRTSIEKNNIGNKTVENCVCILRNLSYRC 445
            :|.|.:|.|||:||..|..|..:|....||:.|:..::.|:::....||.||||||:||||||:.
Zfish   469 IFFNTTGCLRNLSSVNERTRQQMRETRGLVDSLVGYIQNSLQEGKGENKGVENCVCVLRNLSYQL 533

  Fly   446 QEVDDPNYDKHPFITPERV-----IPSSSKGENLGCFGTNKKKKEANNSDALNEYNISADYSKSS 505
                   |.:.|.....|:     ...:...:.:|||....||.:..|.|......::       
Zfish   534 -------YSEIPSSVQMRLEGPTRAQDTRHSDAIGCFTPQSKKAKDRNQDLTTFTEVA------- 584

  Fly   506 VTYNKLNKGYEQLWQPEVVQYYLSLLQSC-SNPETLEAAAGAIQNLSA--CYWQPSIDIRATVRK 567
                ::.||.|.||.|::|..|..:|||| :|..|.||||||:||::|  ..| .|:..|..:.:
Zfish   585 ----RVPKGAEWLWHPQIVSLYNQILQSCEANTATREAAAGALQNITAGDSRW-ASVLSRVALEQ 644

  Fly   568 EKGLPILVELLRMEVDRVVCAVATALRNLAIDQRNKELIGKYAMRDLVQKLPSGNVQHDQNTSDD 632
            |:.||::::|||...|..:.::...||||:...:||..:....:..||.||||..  |.:..|.:
Zfish   645 ERMLPVILDLLRSPTDAELRSLTGLLRNLSRHCKNKADMATKVVNVLVNKLPSDG--HQKEPSSE 707

  Fly   633 TITAVLATINEVIKKNPEFSRSLLDSGGIDRLMNITKRKEKYTSCV--LKFASQVLYTMWQHNEL 695
            .:..:...:|.::..:...:|.:....|:.:|::|....:.....:  .:.||.||..|:|:|:|
Zfish   708 VVVNICGVLNNLVTGSSLAARDITYFDGLPKLVSIKSSHDNSPGKLKAARAASTVLSNMFQYNKL 772

  Fly   696 RDVYKKNGWKEQDF 709
            ...||:.|:..:||
Zfish   773 HRDYKQKGFARRDF 786

Known Domains:


GeneSequenceDomainRegion External IDIdentity
p120ctnNP_001036444.1 ARM 227..341 CDD:237987 45/114 (39%)
armadillo repeat 227..252 CDD:293788 8/25 (32%)
armadillo repeat 260..296 CDD:293788 17/36 (47%)
armadillo repeat 304..339 CDD:293788 14/35 (40%)
ARM 307..442 CDD:237987 53/137 (39%)
armadillo repeat 347..392 CDD:293788 15/47 (32%)
armadillo repeat 515..556 CDD:293788 22/44 (50%)
ARM 516..643 CDD:237987 46/130 (35%)
armadillo repeat 562..596 CDD:293788 11/34 (32%)
armadillo repeat 601..641 CDD:293788 10/40 (25%)
pkp3bXP_002662884.1 ARM 320..427 CDD:237987 45/110 (41%)
armadillo repeat 349..385 CDD:293788 17/36 (47%)
armadillo repeat 391..425 CDD:293788 14/35 (40%)
armadillo repeat 446..480 CDD:293788 13/34 (38%)
ARM 641..768 CDD:237987 31/129 (24%)
armadillo repeat 641..673 CDD:293788 10/32 (31%)
armadillo repeat 680..721 CDD:293788 10/43 (23%)
armadillo repeat 727..766 CDD:293788 8/39 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C87382050
eggNOG 1 0.900 E1_KOG1048
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D125744at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR10372
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.