DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and ARHGAP22

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_011538304.1 Gene:ARHGAP22 / 58504 HGNCID:30320 Length:720 Species:Homo sapiens


Alignment Length:313 Identity:79/313 - (25%)
Similarity:135/313 - (43%) Gaps:56/313 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   314 SETDM----KRLQTILWLEL--ATIFDRNKVSLDKRKPFKRRRKEEGNLFGVSINALIRRDQQVT 372
            |:.||    :.::.::|..|  .|....:...|:...|         .:||..:...:..:::. 
Human   135 SQRDMEDWVQAIRRVIWAPLGGGTARRSHAHPLEPLPP---------GIFGQRLEETVHHERKY- 189

  Fly   373 GTDSSLVPLFLEKLIGELLRRGSREEGLLRIGGHKQKTELLYNELESTF--YQNPDNLDNLFRTA 435
              ...|.||.:|:.:..:..||..||||.|:.|...    |..:|:.:|  .:.|     ||.:.
Human   190 --GPRLAPLLVEQCVDFIRERGLTEEGLFRMPGQAN----LVRDLQDSFDCGEKP-----LFDST 243

  Fly   436 T-VHELSSLLKRWLRELPQPLLTNELIQLFYQCHTLPSIDQMNA---LSILCHLLPPENRNTLRS 496
            | ||.::||||.:|||||:|::.....:.|..|..|.:.|:...   |:.....||..|.|.||.
Human   244 TDVHTVASLLKLYLRELPEPVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRY 308

  Fly   497 LLSFFNIIINLKDINKMNVHNVATIMAPSMFPPRYIHP---SDNNSIAEQVRMAAQCCRLTNILI 558
            :..|.:.:....::|||:|.|:||:..|::..|:...|   .:..|:.:         .|..:||
Human   309 ICKFLDEVQAYSNVNKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQ---------HLMTVLI 364

  Fly   559 LRGEKLFQVPNNLIVESQKTMMG----KKGWHRHRNSNEITAKPSGKASNVGV 607
            .:..:||..|   :.|...:..|    ..||    .|.|:|....|:....|:
Human   365 RKHSQLFTAP---VPEGPTSPRGGLQCAVGW----GSEEVTRDSQGEPGGPGL 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 63/228 (28%)
ARHGAP22XP_011538304.1 PH_RhoGAP2 42..157 CDD:241529 5/21 (24%)
RhoGAP_ARHGAP22_24_25 173..371 CDD:239855 59/218 (27%)
SMC_N <612..>700 CDD:330553
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.