DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment conu and Arhgap33

DIOPT Version :9

Sequence 1:NP_001036454.1 Gene:conu / 3355133 FlyBaseID:FBgn0039994 Length:629 Species:Drosophila melanogaster
Sequence 2:XP_038949821.1 Gene:Arhgap33 / 100362311 RGDID:2318374 Length:1354 Species:Rattus norvegicus


Alignment Length:311 Identity:67/311 - (21%)
Similarity:118/311 - (37%) Gaps:64/311 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   342 KRKPFKRRRKEEG----NLFGVSINALIRRDQQVTGTDSSLVPLFLEKLIGELLRRGSREEGLLR 402
            :.:|.::|.::.|    .:||..:...:..    :|.|   ||..| :...|.:......:|:.|
  Rat   363 RSRPSRQRLRQRGILRQRVFGCDLGEHLSN----SGQD---VPQVL-RCCSEFIEAHGVVDGIYR 419

  Fly   403 IGGHKQKTELLYNELESTFYQNPDNLDNLFRTA---TVHELSSLLKRWLRELPQPLLTNELIQLF 464
            :.|.....:.|.:|.:|      :.:..|...|   .:|.:|||.|.:.||||.||||.:|...|
  Rat   420 LSGVSSNIQRLRHEFDS------ERIPELSGPAFLQDIHSVSSLCKLYFRELPNPLLTYQLYGKF 478

  Fly   465 YQCHTLPSIDQ-MNALSILCHLLPPENRNTLRSLLSFFNIIINLKDINKMNVHNVATIMAPSMFP 528
            .:..::|..:: :..:..:...|||.:..||..||.....:........|:..|:|.:.||::..
  Rat   479 SEAMSVPGEEERLVRVHDVIQQLPPPHYRTLEYLLRHLARMARHSANTSMHARNLAIVWAPNLLR 543

  Fly   529 PRYIHPSDNNSIA--EQVRMAAQCCR--LTNILIL------------RGEKLFQVPNNL------ 571
            ...:........|  .:||:.:....  ||::.:|            .|..|...|.:|      
  Rat   544 SMELESVGLGGAAAFREVRVQSVVVEFLLTHVEVLFSDTFTSAGLDPAGRCLLPRPKSLAGSSPS 608

  Fly   572 -----IVESQKTMMGKKGW---------------HRHRNSNEITAKPSGKA 602
                 :.|:|....|:.|.               .|.|...|...||.|.:
  Rat   609 TRLLTLEEAQARTQGRLGTPTEPTTPKTPASPVERRKRERVEKQRKPGGSS 659

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
conuNP_001036454.1 RhoGAP_ARHGAP18 356..576 CDD:239856 55/250 (22%)
Arhgap33XP_038949821.1 PX_TCGAP 125..237 CDD:132832
SH3_ARHGAP32_33 259..312 CDD:212769
RhoGAP_CdGAP 380..574 CDD:239849 48/207 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.