DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gpb5 and GPHB5

Sequence 1:NP_001104334.1 Gene:Gpb5 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_660154.3 Gene:GPHB5 HGNCID:18055 Length:130 Species:Homo sapiens

Alignment Length:133 Identity:37/134 (28%)
Similarity:63/134 (47%) Gaps:10/134 (7%)


  Fly    12 IFVGTSVVLVSVSSSSLSEIKPMNNGHIVTPLGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGR 76
            :|:|...:|:......   :...::|::.|.:||..|.:|:...:...:|..    ::..:||||
Human     6 LFLGPMALLLLAGYGC---VLGASSGNLRTFVGCAVREFTFLAKKPGCRGLR----ITTDACWGR 63

  Fly    77 CDSSEISDWKFPYKRSFHPVCVHAQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDT 141
            |::.|....:.||..:.|.||.:.:.:.|...|.||.|..:..   |.|..|:.|.|..|||..|
Human    64 CETWEKPILEPPYIEAHHRVCTYNETKQVTVKLPNCAPGVDPF---YTYPVAIRCDCGACSTATT 125

  Fly   142 SCE 144
            .||
Human   126 ECE 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 30/99 (30%)
GPHB5NP_660154.3 GHB_like 36..129 CDD:200450 31/101 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99819722
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 64 1.000 Inparanoid score I5285
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1362225at2759
OrthoFinder 1 1.000 FOG0001553
OrthoInspector 1 1.000 T1072878
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR11515
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R5224
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1010.040

Return to query results.
Submit another query.