DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and CGB2

DIOPT Version :10

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_203696.2 Gene:CGB2 / 114336 HGNCID:16722 Length:163 Species:Homo sapiens


Alignment Length:85 Identity:15/85 - (17%)
Similarity:26/85 - (30%) Gaps:28/85 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PVCVHAQRQL-------VVAILKNCHPKAEDSVSKYQ---------------------YMEAVNC 131
            |||:.....:       :..:|:...|.....|..|:                     |..|::|
Human    42 PVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSC 106

  Fly   132 HCQTCSTQDTSCEAPANNEM 151
            .|..|....|.|..|.::.:
Human   107 QCALCRRSTTDCGGPKDHPL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 13/76 (17%)
CGB2NP_203696.2 GHB 23..129 CDD:214502 15/85 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..163
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.