DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and CGB2

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_203696.2 Gene:CGB2 / 114336 HGNCID:16722 Length:163 Species:Homo sapiens


Alignment Length:85 Identity:15/85 - (17%)
Similarity:26/85 - (30%) Gaps:28/85 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 PVCVHAQRQL-------VVAILKNCHPKAEDSVSKYQ---------------------YMEAVNC 131
            |||:.....:       :..:|:...|.....|..|:                     |..|::|
Human    42 PVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSC 106

  Fly   132 HCQTCSTQDTSCEAPANNEM 151
            .|..|....|.|..|.::.:
Human   107 QCALCRRSTTDCGGPKDHPL 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 13/76 (17%)
CGB2NP_203696.2 GHB 23..129 CDD:214502 15/85 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 129..163
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.