DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gpb5 and CGB3

Sequence 1:NP_001104334.1 Gene:Gpb5 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:NP_000728.1 Gene:CGB3 HGNCID:1886 Length:165 Species:Homo sapiens

Alignment Length:85 Identity:15/86 (17%)
Similarity:26/86 (30%) Gaps:28/86 (33%)


  Fly    95 PVCVHAQRQL-------VVAILKNCHPKAEDSVSKYQ---------------------YMEAVNC 131
            |||:.....:       :..:|:...|.....|..|:                     |..|::|
Human    44 PVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSC 108

  Fly   132 HCQTCSTQDTSCEAPANNEM 151
            .|..|....|.|..|.::.:
Human   109 QCALCRRSTTDCGGPKDHPL 128

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 14/77 (18%)
CGB3NP_000728.1 GHB 25..131 CDD:214502 15/86 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C99821499
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001553
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.930

Return to query results.
Submit another query.