DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gpb5 and gphb5

DIOPT Version :9

Sequence 1:NP_001104334.1 Gene:Gpb5 / 3355097 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017952316.1 Gene:gphb5 / 100494400 XenbaseID:XB-GENE-993177 Length:126 Species:Xenopus tropicalis


Alignment Length:109 Identity:36/109 - (33%)
Similarity:52/109 - (47%) Gaps:7/109 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 NNGHIVTPLGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVH 99
            :|..:.|.:||..|.:|:...:...:|..    |:..:|||||::.|......||..:.|.||.:
 Frog    22 SNISLRTFIGCAVREFTFLAKKPGCKGLR----VTTDACWGRCETWEKPVLDPPYIEAHHRVCTY 82

  Fly   100 AQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            .:.:||...|.||.|   |....:.|..||.|.|..|||..|.|
 Frog    83 NETKLVTVKLPNCSP---DIDPFFTYPVAVRCDCDICSTSTTEC 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 33/99 (33%)
gphb5XP_017952316.1 GHB_like 32..126 CDD:200450 33/99 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10675
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5203
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto103691
Panther 1 1.100 - - O PTHR11515
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.070

Return to query results.
Submit another query.