DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gpb5 and gphb5

Sequence 1:NP_001104334.1 Gene:Gpb5 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017952316.1 Gene:gphb5 XenbaseID:XB-GENE-993177 Length:126 Species:Xenopus tropicalis

Alignment Length:109 Identity:36/110 (33%)
Similarity:52/110 (47%) Gaps:7/110 (6%)


  Fly    35 NNGHIVTPLGCHRRVYTYKVTQSDLQGHECWDYVSVWSCWGRCDSSEISDWKFPYKRSFHPVCVH 99
            :|..:.|.:||..|.:|:...:...:|..    |:..:|||||::.|......||..:.|.||.:
 Frog    22 SNISLRTFIGCAVREFTFLAKKPGCKGLR----VTTDACWGRCETWEKPVLDPPYIEAHHRVCTY 82

  Fly   100 AQRQLVVAILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            .:.:||...|.||.|   |....:.|..||.|.|..|||..|.|
 Frog    83 NETKLVTVKLPNCSP---DIDPFFTYPVAVRCDCDICSTSTTEC 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 33/100 (33%)
gphb5XP_017952316.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1362225at2759
OrthoFinder 1 1.000 FOG0001553
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.