DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Gpb5 and LOC100001596

Sequence 1:NP_001104334.1 Gene:Gpb5 FlyBaseID:FBgn0063368 Length:169 Species:Drosophila melanogaster
Sequence 2:XP_017209108.2 Gene:LOC100001596 ID: Length:192 Species:Danio rerio

Alignment Length:106 Identity:30/107 (28%)
Similarity:45/107 (42%) Gaps:15/107 (14%)


  Fly    43 LGCHRRVYTYKVTQSDLQGHECWDYVSVWS--CWGRCDSSEISDWKFPYKR-SFHPVCVHAQRQL 104
            |.|..:.||..|     :.|||...:::.:  |.|.|.:.:.:...|..|| .....|:|  |.|
Zfish    79 LACSLKNYTLYV-----EKHECGHCMAINTTVCSGMCFTRDTNVQGFVGKRFLLQQSCMH--RSL 136

  Fly   105 VV--AILKNCHPKAEDSVSKYQYMEAVNCHCQTCSTQDTSC 143
            |.  |.:..| |...|.:  :.|..|..|:|..|:|....|
Zfish   137 VYRSARMPGC-PVHIDPL--FFYPVARRCNCTKCNTSRNEC 174

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Gpb5NP_001104334.1 GHB_like 45..144 CDD:200450 29/105 (28%)
LOC100001596XP_017209108.2 GHB_like 81..177 CDD:200450 29/105 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1362225at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.