DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS3 and INTS3

DIOPT Version :8

Sequence 1:NP_001036437.1 Gene:IntS3 / 3355010 FlyBaseID:FBgn0262117 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_001311404.1 Gene:INTS3 / 65123 HGNCID:26153 Length:1042 Species:Homo sapiens

Alignment Length:1095 Identity:424/1096 (39%)
Similarity:639/1096 (58%) Gaps:127/1096 (12%)


  Fly    14 KLFICTAVDCKDDIEEKFERSFVTLQMQISGLSDKEMHDMLSQAVCKE-KQHEEISIGFLYIMLT 77
            :|.:.|::|.||::||:.||....:....:|:|::|.:|.|:..|||. .|||||.:|...::||
Human    35 RLLLSTSLDAKDELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGLPQHEEICLGLFTLILT 99

  Fly    78 DPSMASKTYRDVTLVSRDGMNGIVTNLTFLVAEKYTKLTEVARRQLIWLLREFVKHQVLSVENVI 142
            :|:.|.|.|||:.||||||||.::..:..::.|||.||.:..|.||:||:||.||..||..:.|.
Human   100 EPAQAQKCYRDLALVSRDGMNIVLNKINQILMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVC 164

  Fly   143 WNCLRQAGGGDVSSRNLFLIESLLDIFIEFRTWLETNPFLVQSTVYSFVRLIEDHANPA-LLSLR 206
            ...::|..||||:::|::|.||:|||..|.|.|:..:..|:...||:::|||.||...| |.:||
Human   165 MTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQALR 229

  Fly   207 QKEVKFTISLIRERFHDIIPLGRDFVRLLQNVARIPEFEQLWRDILFNPKMLHQTFNGIWQLLHI 271
            ||||.|.|||:||||.:.:.:|||.||||||||||||||.||:||:.||:.|...|.||.|||..
Human   230 QKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQS 294

  Fly   272 RTSRRFLQCRLLPEMERKISFLASSVKFGNQKRYQDWFQDKYFATPESHSLRSDLIRFIINVIHP 336
            ||||:||.|||.|:||.|:.|:.|.|:||.|||||||||.:|.:||:|.|||.||||:|..|:||
Human   295 RTSRKFLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHP 359

  Fly   337 TNDMLCSDIIPRWAIIGWLISSCTNPIASANAKLSLFYDWLFFDPAKDNIMNIEPGILVMYHSIR 401
            :|::|.|||:|||||||||:::||:.:|::||||:||||||||.|.||:||||||.||||:||::
Human   360 SNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVMHHSMK 424

  Fly   402 NHPFVSSTLLDFLCRITKNFFVKHEDKIRIGVYNSLKLILEKQVIPNLQPLFESPKLDRELRNLI 466
            .||.:::|||||:|||..||:...|..:|.||::||..|:||:|:.:|.|||::||||:|||.::
Human   425 PHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRAML 489

  Fly   467 RDNFREFLSPPANHGQLLFTSLHPVQGHILKKESDQRILHCENMDLHETGLINISGTIDEDKKIL 531
            |:.|.||.|.|:          .||:..|.:..|.:       ||.|.:         |:|:...
Human   490 REKFPEFCSSPS----------PPVEVKIEEPVSME-------MDNHMS---------DKDESCY 528

  Fly   532 LVPTDQEIESVFSDETAENLR--------RVHNIEDNTDD------------DDDLPLSEVRLKE 576
                 ...|:.|||: .|:|.        |.|.|::...:            |:.|....::|::
Human   529 -----DNAEAAFSDD-EEDLNSKGKKREFRFHPIKETVVEEPVDITPYLDQLDESLRDKVLQLQK 587

  Fly   577 KPKVEL-AEAIAESFDAFVTKRNSYTWEAFLKDFRPLPASAFEE-FQLNYVISNTVLILRETLPQ 639
            ....|. .|.:.|..|..:.       |.|..:...:.||..:| |:.::        ..|.|| 
Human   588 GSDTEAQCEVMQEIVDQVLE-------EDFDSEQLSVLASCLQELFKAHF--------RGEVLP- 636

  Fly   640 QNIFSESKTEEKHLAKSISYPLYGLFRFL--YENDEKSKKPFQTLLSEICEGIPEIGYLLLYFMK 702
                 |..|||. |.:|:..|||.:||.|  .:.|..|......||||:.:..|:|||.|||:::
Human   637 -----EEITEES-LEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKIGYHLLYYLR 695

  Fly   703 IYCKLQTRKNSQQSYQFKTTIYRQICDAADEKIGNCLLRDLDLLEKENTNIFLWLLPDIYREFKS 767
            .......:.|..:|:...|    |:.|     :..||:.|:...::::..:...|.|.||.||..
Human   696 ASKAAAGKMNLYESFAQAT----QLGD-----LHTCLMMDMKACQEDDVRLLCHLTPSIYTEFPD 751

  Fly   768 IATNNTDLLRITLRCIDAKNVRDILYSIAQGKLTIFKQDGLIDCIRQSLEFETYEQFCLWQIVQA 832
            ....:.:||.:.:..||:..:::::..:..|.|.:|::|.:::.:.|||::||:||:|.||:..|
Human   752 ETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQYCAWQLFLA 816

  Fly   833 HDVPLRCIQDILPELEAGSHPEALSHFLLLLKNEEPTNEIIRLMLSRESKSKGDPFVTSALRFWC 897
            |::||..|..||..|:...||||||..||.|:.|:|:.|:::::|||.. ...|.|.||.||.||
Human   817 HNIPLETIIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPC-HPDDQFTTSILRHWC 880

  Fly   898 QRYEEKLSEIIASLLTSKYPSSSPNKRKRPPKGISVSTSTP-----SADQVLNHLEHYRRSCRHG 957
            .:::|.|:|.|.|||...  :|.|.||:      |:.:|:.     :.:|:|.||::.|.:..: 
Human   881 MKHDELLAEHIKSLLIKN--NSLPRKRQ------SLRSSSSKLAQLTLEQILEHLDNLRLNLTN- 936

  Fly   958 TGTGLYVHDMMQRALQSAYSHSNDSTKKQFCDLFALAAE-EDTTV----GRRGGSGRGRKQPGSK 1017
            |....:....:.:|||...:..:::.|.:|.|||:||.| ||::.    .||..:   ...|.|:
Human   937 TKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSSTKPPKSRRKAA---LSSPRSR 998

  Fly  1018 KDVNNHGTSKKNPEMVKTIYSSDDNSSEEDWSKSKILQTAKRRKKAN----NDSD 1068
            |    :.|...|.|.    .|...::|||:.:|.|   ..||::|.:    :|||
Human   999 K----NATQPPNAEE----ESGSSSASEEEDTKPK---PTKRKRKGSSAVGSDSD 1042

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IntS3NP_001036437.1 DUF2356 247..471 CDD:287198 134/224 (60%)
INTS3NP_001311404.1 Ints3 270..494 CDD:313427 134/224 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273736047
eggNOG 1 0.900 E1_KOG4262
Hieranoid 1 1.000
Homologene 1 1.000 H11309
Inparanoid 1 1.050 689 1.000 Inparanoid score I682
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D58799at33208
OrthoFinder 1 1.000 FOG0006301
OrthoInspector 1 1.000 T1073169
orthoMCL 1 0.900 OOG5_132547
Panther 1 1.100 LDO PTHR13587
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4237
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.800

Return to query results.
Submit another query.