DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS3 and Ints3

DIOPT Version :8

Sequence 1:NP_001036437.1 Gene:IntS3 / 3355010 FlyBaseID:FBgn0262117 Length:1068 Species:Drosophila melanogaster
Sequence 2:XP_017446796.1 Gene:Ints3 / 361988 RGDID:1304593 Length:1066 Species:Rattus norvegicus

Alignment Length:1105 Identity:422/1106 (38%)
Similarity:644/1106 (58%) Gaps:122/1106 (11%)


  Fly    14 KLFICTAVDCKDDIEEKFERSFVTLQMQISGLSDKEMHDMLSQAVCK-EKQHEEISIGFLYIMLT 77
            :|.:.|::|.||::||:.||....:....:|:|::|.:|.|:..||| ..|||||.:|...::||
  Rat    34 RLLLSTSLDAKDELEERLERCMSIVTSMTAGVSEREANDALNAYVCKGPPQHEEICLGLFTLVLT 98

  Fly    78 DPSMASKTYRDVTLVSRDGMNGIVTNLTFLVAEKYTKLTEVARRQLIWLLREFVKHQVLSVENVI 142
            :|:.|.|.|||:.||||||||.::..:..|:.|||.||.:..|.||:||:||.||..||..:.|.
  Rat    99 EPAQAQKCYRDLALVSRDGMNIVLNKINQLLMEKYLKLQDTCRTQLVWLVRELVKSGVLGADGVC 163

  Fly   143 WNCLRQAGGGDVSSRNLFLIESLLDIFIEFRTWLETNPFLVQSTVYSFVRLIEDHANPA-LLSLR 206
            ...::|..||||:::|::|.||:|||..|.|.|:..:..|:...||:::|||.||...| |.:||
  Rat   164 MTFMKQIAGGDVTAKNIWLAESVLDILTEQREWVLKSSILIAMAVYTYLRLIVDHHGTAQLQTLR 228

  Fly   207 QKEVKFTISLIRERFHDIIPLGRDFVRLLQNVARIPEFEQLWRDILFNPKMLHQTFNGIWQLLHI 271
            ||||.|.|||:||||.:.:.:|||.||||||||||||||.||:||:.||:.|...|.||.|||..
  Rat   229 QKEVDFCISLLRERFMECLMIGRDLVRLLQNVARIPEFELLWKDIIHNPQALSPQFTGILQLLQS 293

  Fly   272 RTSRRFLQCRLLPEMERKISFLASSVKFGNQKRYQDWFQDKYFATPESHSLRSDLIRFIINVIHP 336
            ||||:||.|||.|:||.|:.|:.|.|:||.|||||||||.:|.:||:|.|||.||||:|..|:||
  Rat   294 RTSRKFLACRLTPDMETKLLFMTSRVRFGQQKRYQDWFQRQYLSTPDSQSLRCDLIRYICGVVHP 358

  Fly   337 TNDMLCSDIIPRWAIIGWLISSCTNPIASANAKLSLFYDWLFFDPAKDNIMNIEPGILVMYHSIR 401
            :|::|.|||:|||||||||:::||:.:|::||||:||||||||.|.||:||||||.||||:||::
  Rat   359 SNEVLSSDILPRWAIIGWLLTTCTSNVAASNAKLALFYDWLFFSPDKDSIMNIEPAILVMHHSMK 423

  Fly   402 NHPFVSSTLLDFLCRITKNFFVKHEDKIRIGVYNSLKLILEKQVIPNLQPLFESPKLDRELRNLI 466
            .||.:::|||||:|||..||:...|..:|.||::||..|:||:|:.:|.|||::||||:|||:::
  Rat   424 PHPAITATLLDFMCRIIPNFYPPLEGHVRQGVFSSLNHIVEKRVLAHLAPLFDNPKLDKELRSML 488

  Fly   467 RDNFREFLSPPANHGQLLFTSLHPVQGHILKKESDQRILHCENMDLHETGLINISGTIDEDKKIL 531
            |:.|.||.|.|:...:..|.....:.|              ......|:..:.....|:|     
  Rat   489 REKFPEFCSSPSPPVEASFPEASGILG--------------STRGYQESFFLYSQVKIEE----- 534

  Fly   532 LVPTDQEIESVFSDETAENLRRVHNIEDN-----TDDDDDL------------PLSEVRLKEKPK 579
              |...|:::..||:.       .:..||     :||::||            |:.|..::|...
  Rat   535 --PVSMEMDNHLSDKD-------ESCYDNAEAAFSDDEEDLNSKGKKREFRFHPIKETVVEEPVD 590

  Fly   580 V-----ELAEAIAESFDAFVTKRNSYTWEAFLKDFRPLPASAFEE----FQLNYVISNTVLILR- 634
            |     :|.|::.:.  ....::.|.| ||..:..:.:.....||    .||:.:.|....:.: 
  Rat   591 VTPYLDQLDESLRDK--VLQLQKGSDT-EAQCEVMQEIVDQVLEEDFDSEQLSVLASCLQELFKA 652

  Fly   635 ----ETLPQQNIFSESKTEEKHLAKSISYPLYGLFRFL--YENDEKSKKPFQTLLSEICEGIPEI 693
                |.||      |..|||. |.:|:..|||.:||.|  .:.|..|......||||:.:..|:|
  Rat   653 HFRGEVLP------EEVTEES-LEESVGKPLYLIFRNLCQMQEDNSSFSLLLDLLSELYQKQPKI 710

  Fly   694 GYLLLYFMKIYCKLQTRKNSQQSYQFKTTIYRQICDAADEKIGNCLLRDLDLLEKENTNIFLWLL 758
            ||.|||:::.......:.|..:|:...|    |:.|     :..||:.|:...::::..:...|.
  Rat   711 GYHLLYYLRASKAAAGKMNLYESFAQAT----QLGD-----LHTCLMMDMKACQEDDVRLLCHLT 766

  Fly   759 PDIYREFKSIATNNTDLLRITLRCIDAKNVRDILYSIAQGKLTIFKQDGLIDCIRQSLEFETYEQ 823
            |.||.||......:.:||.:.:..||:..:::::..:..|.|.:|::|.:::.:.|||::||:||
  Rat   767 PSIYTEFPDETLRSGELLNMIVAVIDSAQLQELVCHVMMGNLVMFRKDSVLNILIQSLDWETFEQ 831

  Fly   824 FCLWQIVQAHDVPLRCIQDILPELEAGSHPEALSHFLLLLKNEEPTNEIIRLMLSRESKSKGDPF 888
            :|.||:..||::||..:..||..|:...||||||..||.|:.|:|:.|:::::|||.. ...|.|
  Rat   832 YCAWQLFLAHNIPLETVIPILQHLKYKEHPEALSCLLLQLRREKPSEEMVKMVLSRPC-HPDDQF 895

  Fly   889 VTSALRFWCQRYEEKLSEIIASLLTSKYPSSSPNKRKRPPKGISVSTSTP-----SADQVLNHLE 948
            .||.||.||.:::|.|:|.|.:||...  :|.|.||:      |:.:|:.     :.:|:|.||:
  Rat   896 TTSILRHWCMKHDELLAEHIKALLIKN--NSLPRKRQ------SLRSSSSKLAQLTLEQILEHLD 952

  Fly   949 HYRRSCRHGTGTGLYVHDMMQRALQSAYSHSNDSTKKQFCDLFALAAE-EDTTVGRRGGSGRGRK 1012
            :.|.:..: |....:....:.:|||...:..:::.|.:|.|||:||.| ||::.          |
  Rat   953 NLRLNLAN-TKQNFFSQTPILQALQHVQASCDEAHKMKFSDLFSLAEEYEDSST----------K 1006

  Fly  1013 QPGS-KKDVNNHGTSKKN----PEMVKTIYSSDDNSSEEDWSKSKILQTAKRRKKAN----NDSD 1068
            .|.| :|...:...|:||    |...:.  |...::|||:.:|.|   ..||::|.:    :|||
  Rat  1007 PPKSRRKAALSSPRSRKNAAQPPNAEEE--SGSSSASEEEDTKPK---PTKRKRKGSSAVGSDSD 1066

  Fly  1069  1068
              Rat  1067  1066

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IntS3NP_001036437.1 DUF2356 247..471 CDD:287198 134/224 (60%)
Ints3XP_017446796.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C273734948
eggNOG 1 0.900 E1_KOG4262
Hieranoid 1 1.000
Homologene 1 1.000 H11309
Inparanoid 1 1.050 691 1.000 Inparanoid score I648
OMA 1 1.010
OrthoDB 1 1.010 D58799at33208
OrthoFinder 1 1.000 FOG0006301
OrthoInspector 1 1.000 T1086810
orthoMCL 1 0.900 OOG5_132547
Panther 1 1.100 LDO PTHR13587
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1312.770

Return to query results.
Submit another query.