DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment IntS3 and Y92H12A.4

DIOPT Version :8

Sequence 1:NP_001036437.1 Gene:IntS3 / 3355010 FlyBaseID:FBgn0262117 Length:1068 Species:Drosophila melanogaster
Sequence 2:NP_001293423.1 Gene:Y92H12A.4 / 3565441 WormBaseID:WBGene00022360 Length:1052 Species:Caenorhabditis elegans

Alignment Length:1163 Identity:269/1164 (23%)
Similarity:503/1164 (43%) Gaps:208/1164 (18%)


  Fly     1 MEQQQSKNNAHVSKLF-ICTAVDCKDDIEEKFERSFVTLQMQISGLSDKEMHDMLSQAVCKEKQH 64
            |.:||::   .:.||. |....:...::..:.....:.|..:|:|.||||:.|::   :.|| :|
 Worm     1 MNEQQTR---RIQKLMKINLKCETPPELVARLANDSIVLDSRITGKSDKEVIDIM---ISKE-EH 58

  Fly    65 EEISIGFLYIMLT---DPSMASKTYRDVTLVSRDGMNGIVTNLTFLVAEKYTKLTEVARRQLIWL 126
            :..|||.:|.:||   :|.:..|..|.||....:..:.::.|:..::.|.:..|..:.:.||:.|
 Worm    59 DVKSIGLMYHILTSGENPDLFGKMIRYVTGGGAEYWHHVLCNMNMILFEVWPFLHLLCKEQLLRL 123

  Fly   127 LREFVKHQVLSVENVIWNCLRQA-GGGDVSSRNLFLIESLLDIFIEFRTWLETN---PFLVQSTV 187
            :||.|:..|..||||:.|..|.: |..|.:::....:: |..:..|...|.::.   ..||.:.:
 Worm   124 IREAVRQNVKQVENVLMNAFRMSIGSSDFATKQRIFMK-LNSMIRENEAWFKSQKACAALVANIL 187

  Fly   188 YSFVRLIEDHANPALLS----LRQKEVKFTISLIRERFHDIIPLGRDFVRLLQNVARIPEFEQLW 248
            .....:|  .::||.:|    .|:.::.....:|:.|..|.:.|||||:.:|..:.::|:.|::|
 Worm   188 TCTTSVI--ISSPAPISSQDTFRESQLDLVQWVIKSRKIDCLTLGRDFILILIRLGKMPQIEEIW 250

  Fly   249 RDILFNPKMLHQTFNGIWQLLHIRTSRRFLQ-CRLLPEMERKISFLASSVKFG-NQKRYQDWFQD 311
            :||:.||...     |:..|....|.:..|| .|:..|:|||:.|:.  |..| |...|..|..:
 Worm   251 KDIVANPASF-----GVSNLEEYMTKQNVLQHVRISIELERKVQFMV--VNGGKNLLTYFTWLNN 308

  Fly   312 KYFATPESHSLRSDLIRFIINV-IHPTNDM------------LCSDIIPRWAIIGWLISSCTNPI 363
            |:|...:..:||::.:|::::: :.|...:            |....:|....:.||        
 Worm   309 KFFRANDGPALRAECVRYVLSMNLDPAKALPNAQENRVQLLHLLISTVPSGPELQWL-------- 365

  Fly   364 ASANAKLSLFYDWLFFDPAKD-NIMNIEPGILVMYHSIRNHP----------------FVSSTLL 411
                 ||.||.||...|.... |:|.:|....|:.:::...|                |.:| ||
 Worm   366 -----KLCLFADWFGCDDKNSANLMCVENSFSVVRYALFLTPTGPQQNSIVQGSHCSQFANS-LL 424

  Fly   412 DFLCRITKNFF-VKHEDKIRIGVYNSLKLILEKQVIPNLQPLFESPKLDRELRNLIRDNFREFLS 475
            :|||:...... ..:.:.||..|.::::.|.:: :..||..:.|:.|:||::..|:|:.|.:|:.
 Worm   425 EFLCKSVDVLLPPAYAEPIRRNVNSAMRFIKDR-LQHNLPQILENSKIDRKVSELLRNVFPDFVR 488

  Fly   476 PPANHGQLLFTSLHPVQGHILKKESDQRIL----HCENMDLHETGLINISGT--IDED--KKILL 532
            .|..:..::.............|.|.:..|    ..|........|.:.|.|  |:::  ||.:.
 Worm   489 NPIGNSSIIRPKKKSTDEEKAIKSSSEPALSEQKSTEKPSFSTEKLSSDSATTKIEKEKLKKAIE 553

  Fly   533 VPTDQEIESVFSDETAENLRRVHNIEDNTDDDDDLPLSEVRLKEKPKVELAEAIAESFDAFVTKR 597
            ...:||:..:......|...::..::|...:.||         :..|.|..|.:..|   .:|  
 Worm   554 EQEEQELNVLIKQLQGEIGTKIAKLKDQWKEFDD---------DADKCEAVEGLLVS---LLT-- 604

  Fly   598 NSYTWEAFLKDFRPLPASAFEEFQLNYVISNTVLILRETLPQQNIFSESKTEEKHLAKSISYPLY 662
               |.:.|.:..:.|.|..     |..::.:.|...:..||         ..||.|:::.::|:|
 Worm   605 ---TGDVFDESQQELAAQC-----LLGIMGSVVADEQSLLP---------PNEKDLSEAFTHPIY 652

  Fly   663 GLFRFLY---ENDEKSKKPFQTLLSEICEGIPEIGYLLLYFMK----------IYCKLQTRKNSQ 714
            ...:.|.   :|||.|......:::.:.|....:.|:.|||:|          |.|         
 Worm   653 SFLKVLCSPPDNDEASSDVMAAMMAAMREKDSSLTYVFLYFIKGTAGGRPTECIEC--------- 708

  Fly   715 QSYQFKTTIYRQICDAADEKIGNCLLRDLDLLEKENTNIFLWLLPDIYREFKSIATNNTDLLRIT 779
                     |:.|...:...:...|..||.|....:..:|.:|:|.::.:|:....:...||...
 Worm   709 ---------YKNIAKMSGRSVDEMLASDLQLCAVNDNRLFAYLVPFVFSQFEEEVMSTPALLATL 764

  Fly   780 LRCIDAKNVRDILYSIAQGKLTIFKQDGLIDCIRQSLEFETYEQFCLWQIVQAHDVPLRCIQDIL 844
            ...:||..:|..:..|.:.::.||:::.....:..|:::.|..|:..|.:|.|..||:......:
 Worm   765 CANLDAIQLRSFVSEIIREEIKIFRKESFPKMVMDSVDWATTPQWVFWHLVHADGVPIEWFLSTI 829

  Fly   845 PELEAGSHPEALSHFLLLLK--NEEPTNEIIRLMLSRESKSKGDPFVTSALRFWCQRYE--EKLS 905
            |:.:|..|.||:::.||::|  :.||...:||.:.:| ..:|.|.|...|::...:..|  :|::
 Worm   830 PKFDAVGHDEAIANILLMMKRMDREPWAGLIRALFNR-VPNKDDTFTIDAMKVLIEDSEQCQKVA 893

  Fly   906 EIIASLLTSKYPSSS-------PNKRKRPPKGISVSTSTPSADQVLNHLEHYRRSC----RHGTG 959
            ||:|.|:.....::.       .:|:..|.|        .:..|||.||:|:..:|    :..|.
 Worm   894 EIVAQLIKKLLGNNDIIGLGVRVHKKGNPMK--------LTLQQVLEHLQHFSSTCVEKKQRMTE 950

  Fly   960 TGLYVHDMMQRA-LQSAYSHSNDSTK-----KQFCDLFAL--AAEEDTTVGRRGGSGRGRKQPGS 1016
            |      .|.|: ||.|::....:.|     |::.:||..  ...:||.......:.||.:|   
 Worm   951 T------FMSRSHLQEAFASIKVNDKAVVLVKKYGNLFGAMDIIAQDTKEHSSSRTLRGNRQ--- 1006

  Fly  1017 KKDVNNHGTSKKNPEMVKTIYSSDDNSSEEDWSKSKILQTAKRRKKANN------DSD 1068
                   |||.:..:| :.::......:|:|      .|.:|:||..||      |||
 Worm  1007 -------GTSAERQQM-QQMHHQKRKPNEDD------EQNSKKRKMHNNIIELSDDSD 1050

Known Domains:


GeneSequenceDomainRegion External IDIdentity
IntS3NP_001036437.1 DUF2356 247..471 CDD:287198 63/257 (25%)
Y92H12A.4NP_001293423.1 DUF2356 249..484 CDD:287198 63/257 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C274031149
eggNOG 1 0.900 E1_KOG4262
Hieranoid 1 1.000
Homologene 1 1.000 H11309
Inparanoid 1 1.050 170 1.000 Inparanoid score I2727
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D58799at33208
OrthoFinder 1 1.000 FOG0006301
OrthoInspector 1 1.000 T474805
orthoMCL 1 0.900 OOG5_132547
Panther 1 1.100 LDO PTHR13587
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4237
TreeFam 1 0.960
1413.800

Return to query results.
Submit another query.