DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED21 and srb7

DIOPT Version :9

Sequence 1:NP_001015223.1 Gene:MED21 / 3354977 FlyBaseID:FBgn0040020 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_596630.1 Gene:srb7 / 2540209 PomBaseID:SPBC1604.10 Length:138 Species:Schizosaccharomyces pombe


Alignment Length:128 Identity:38/128 - (29%)
Similarity:61/128 - (47%) Gaps:15/128 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MADRLTQLQDTVNQQAEHFCNAIGVIQQ----TSLPSKFVNFERIGPQTPIPCPPQE-DYAQ--L 58
            ||.|.||||||:::.|..|.::|..:..    ..||.:    |::......|...:| .:||  |
pombe     1 MACRCTQLQDTIDEVATQFYSSIHYLSSHHDFVPLPGQ----EKVSDSKVNPISAEELQFAQRDL 61

  Fly    59 FAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLE---IENQGTARDLEEVVQKGELLLEK 118
            ...|:.:..: |||||..||...::.:.|...:|:|:   .|.|...:.||...:..:|.|.|
pombe    62 AKDLVTKFMQ-IDTLINQLPGISTAPKHQLEKIKKLQNSIEEKQLERKSLESENEDLKLQLAK 123

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MED21NP_001015223.1 Med21 1..128 CDD:288119 38/128 (30%)
srb7NP_596630.1 Med21 1..130 CDD:314215 38/128 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1510
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0004699
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_104457
Panther 1 1.100 - - LDO PTHR13381
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.900

Return to query results.
Submit another query.