DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MED21 and srb7

DIOPT Version :8

Sequence 1:NP_001015223.1 Gene:MED21 / 3354977 FlyBaseID:FBgn0040020 Length:142 Species:Drosophila melanogaster
Sequence 2:NP_596630.1 Gene:srb7 / 2540209 PomBaseID:SPBC1604.10 Length:138 Species:Schizosaccharomyces pombe

Alignment Length:128 Identity:38/129 (29%)
Similarity:61/129 (47%) Gaps:15/129 (12%)


  Fly     1 MADRLTQLQDTVNQQAEHFCNAIGVIQQ----TSLPSKFVNFERIGPQTPIPCPPQE-DYAQ--L 58
            ||.|.||||||:::.|..|.::|..:..    ..||.:    |::......|...:| .:||  |
pombe     1 MACRCTQLQDTIDEVATQFYSSIHYLSSHHDFVPLPGQ----EKVSDSKVNPISAEELQFAQRDL 61

  Fly    59 FAQLIARCAKDIDTLIESLPNEDSSIELQNSSLKRLE---IENQGTARDLEEVVQKGELLLEK 118
            ...|:.:..: |||||..||...::.:.|...:|:|:   .|.|...:.||...:..:|.|.|
pombe    62 AKDLVTKFMQ-IDTLINQLPGISTAPKHQLEKIKKLQNSIEEKQLERKSLESENEDLKLQLAK 123

Known Domains:


GeneSequenceDomainRegion External IDIdentity
MED21NP_001015223.1 Med21 1..128 CDD:288119 38/129 (29%)
srb7NP_596630.1 Med21 1..130 CDD:314215 38/129 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004154
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR13381
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.