DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and SPP1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_015187.1 Gene:SPP1 SGDID:S000006059 Length:353 Species:Saccharomyces cerevisiae

Alignment Length:412 Identity:78/413 (19%)
Similarity:138/413 (33%) Gaps:121/413 (29%)


  Fly    18 SSKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYKKS 82
            :.:||||||::......|:.||.|::|||..|:.:|....:...::||..|              
Yeast    19 TGEDVYCICKRPDYGELMVGCDGCDDWFHFTCLHIPEQFKDLVFSFYCPYC-------------- 69

  Fly    83 PSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNP--RRRSTFVQERPSEV 145
              ..|:                    |.||...     |||..|.....  :|:.     |.|:.
Yeast    70 --QAGI--------------------TGKNKDA-----IINGEGSLPKTLWKRKC-----RISDC 102

  Fly   146 PNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFESK 210
            ..|..|.:|.        .:||...:.........||              |..:..|:|:.|..
Yeast   103 YKPCLQDSKY--------CSEEHGREFVNDIWSRLKT--------------DEDRAVVKKMVEQT 145

  Fly   211 GTQCNMFRDWSK--------YVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVFAL 267
            | ..:.|:.:.:        .|..::.|:      :|.|.:.|..:....::  :...:..:   
Yeast   146 G-HIDKFKKFGQLDFIDNNIVVKTDDEKE------IFDQIVVRDMTLKTLED--DLQEVQEI--- 198

  Fly   268 GLLPNMPAMKVAMGHVGLLLG---NDLTNNQKSNKNSEA-----SESKTETKPKVKKPKSEGRK- 323
                ::|..|..:..:.:.||   |..|..:|.:.::.:     .|....||.|.||..|..|. 
Yeast   199 ----SLPLFKKKLELLEVYLGWLDNVYTEMRKLDDDAASHVECGKEDSKGTKRKKKKNSSRSRAR 259

  Fly   324 -------SRY-RSPSS---------SLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSE 371
                   |.| |.|.|         |.|.:..:.....|. |....|...|:...:.|.:....|
Yeast   260 KNICGYCSTYERIPCSVEEFVRDFGSNEEATKIHEVCTKW-KCNRHLDWVSTNQEQYLQQIDSLE 323

  Fly   372 TERHKAKHKTSKKEKTSSQRAY 393
            :.:.:.:|....::|..:.:.|
Yeast   324 SMQERLQHLIQARKKQLNIQYY 345

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 15/45 (33%)
SPP1NP_015187.1 PHD_SPP1 24..69 CDD:277186 15/45 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4178
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.