DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and CTI6

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_015144.1 Gene:CTI6 SGDID:S000006102 Length:506 Species:Saccharomyces cerevisiae

Alignment Length:489 Identity:89/490 (18%)
Similarity:171/490 (35%) Gaps:156/490 (32%)


  Fly    11 GEADTAVSSKDVYCICRQSHI---NGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKN 72
            ||.:......:..|||.:...   :||.|.|:.|:.|.||.|:.:..:  ...|.|:|.:|   .
Yeast    62 GEGEVEEEEGETRCICGELDTPDDSGFFIQCEQCSSWQHGYCVSITQD--NAPDKYWCEQC---R 121

  Fly    73 PLLKCTYKKSPSTTGVPKTPKTPKTPKTPKNPK---------------TPKTPKNSKTPKTARII 122
            |.|   ::...:.||..::...|...|..::.:               ..|:|:|  |..|...:
Yeast   122 PEL---HQLFTTDTGEARSIYKPVQEKRRQSRRKARSAAASKSHAANEAEKSPRN--TSNTDDNV 181

  Fly   123 NSIGVRQNPRRRSTFVQERPSEV---PNPSRQSTKLQKAVNYENATE-----EPTEDAEKVDQKP 179
            :.||..::.      |::..|.|   .:.:.:|::.::..:.::|:.     :|.:..:|:..:.
Yeast   182 DDIGDEEDE------VEDEASAVALAKDGNTRSSRRRRRNSMDDASTDQYSLDPGDSDKKLLDRK 240

  Fly   180 KKTAKKKNPKPEDKVTDDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLA 244
            :.|...:..|...::.:.|.|       ||:.|        |....||:.:.....:.       
Yeast   241 RATFMAREEKQYQRMLEKALK-------ESRRT--------SHQEDPESYENDADIYQ------- 283

  Fly   245 RSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTE 309
                                                       |:  |:|.......:.....||
Yeast   284 -------------------------------------------GD--TDNHNGTTRLQTDVMLTE 303

  Fly   310 TKPKVKKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRK-------LVEE 367
            .||. .....:.::|...|...|:|::.||.:.|::    ::|..:.|::.:.|       |...
Yeast   304 GKPD-SVTNDDMKESLRPSKEQSMEKTNDVEKEASQ----EKESSTGSAQDTEKTDEPILPLTSI 363

  Fly   368 SRSETERHKAKHKTSKKEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVIS 432
            |.||.:..||..:.||:...           |:.|..|..|:.:                    |
Yeast   364 SSSEDDSRKASSRGSKRVSK-----------PARKGNRTRRSNT--------------------S 397

  Fly   433 SPTGKKRVCRSQTISADDPLPSQ--PKSTEVSPM 464
            |.|.:.|  ||..|..|.|:..:  |:.|.::.|
Yeast   398 SDTNQNR--RSADIGTDKPVKPRLPPQRTSLNEM 429

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 15/48 (31%)
CTI6NP_015144.1 PHD_MLL5 74..120 CDD:277025 15/48 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 68 1.000 Inparanoid score I1681
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.