DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and KDM7A

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_085150.1 Gene:KDM7A HGNCID:22224 Length:941 Species:Homo sapiens

Alignment Length:610 Identity:124/611 (20%)
Similarity:200/611 (33%) Gaps:185/611 (30%)


  Fly    11 GEADTAVSSKDVYCICRQSH-INGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTEC------ 68
            |.|........|||:|||.: :|.|||.||.|.:||||.|:|:..:.....|.|:|..|      
Human    27 GRASAPPPPPPVYCVCRQPYDVNRFMIECDICKDWFHGSCVGVEEHHAVDIDLYHCPNCAVLHGS 91

  Fly    69 --------FRKNPLLKCTYKKSPSTTGVPKTPKTPKTPKTPKN---------------------- 103
                    :.::...:......|...|.....|..::...|..                      
Human    92 SLMKKRRNWHRHDYTEIDDGSKPVQAGTRTFIKELRSRVFPSADEIIIKMHGSQLTQRYLEKHGF 156

  Fly   104 ------PKTPKTPKNSKTPKTA-----------RIINSIGVRQNPRRRSTFVQERPSEVPNPSRQ 151
                  ||.........:|..:           ::|:.|.|.:....:.| :........||:| 
Human   157 DVPIMVPKLDDLGLRLPSPTFSVMDVERYVGGDKVIDVIDVARQADSKMT-LHNYVKYFMNPNR- 219

  Fly   152 STKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKN--------PKP----------EDKVTD-- 196
             .|:...::.|.:..:.:|..| |....||.:..:|        |||          :|..||  
Human   220 -PKVLNVISLEFSDTKMSELVE-VPDIAKKLSWVENYWPDDSVFPKPFVQKYCLMGVQDSYTDFH 282

  Fly   197 -DAQKPAV-------EKLFE-SKGTQCNM--FRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRY 250
             |....:|       ||:|. .|.|..|:  :..||..|         |...||.......|.: 
Human   283 IDFGGTSVWYHVLWGEKIFYLIKPTDENLARYESWSSSV---------TQSEVFFGDKVDKCYK- 337

  Fly   251 CCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTN-NQKSNKNSEASESKTETKPKV 314
            |..:.|:...:...:...:|.:...|  |.|      ||.|.| |..........|.:.:|....
Human   338 CVVKQGHTLFVPTGWIHAVLTSQDCM--AFG------GNFLHNLNIGMQLRCYEMEKRLKTPDLF 394

  Fly   315 KKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERH---- 375
            |.|..|.                 :....||  .|.|.|         |.:.|...:.:.:    
Human   395 KFPFFEA-----------------ICWFVAK--NLLETL---------KELREDGFQPQTYLVQG 431

  Fly   376 -KAKHKTSK---KEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVISSPTG 436
             ||.|...|   |::..|:.|:.:                      |.|:    :..|:|..   
Human   432 VKALHTALKLWMKKELVSEHAFEI----------------------PDNV----RPGHLIKE--- 467

  Fly   437 KKRVCRSQTISADDPLPSQPKSTEVSPMASAGTSSSNKKPVPETSCQKYRKLS----FTDENCEK 497
                 .|:.|.|.:....:|..::..|:....:.|||:...|..|.:|.|||.    .|..|.:.
Human   468 -----LSKVIRAIEEENGKPVKSQGIPIVCPVSRSSNEATSPYHSRRKMRKLRDHNVRTPSNLDI 527

  Fly   498 IKI-IRCIVS--NMSPTEKALLARK 519
            ::: .|.::.  .|.|.|:.:|:.|
Human   528 LELHTREVLKRLEMCPWEEDILSSK 552

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 21/46 (46%)
KDM7ANP_085150.1 PHD_KDM7 39..88 CDD:277110 22/49 (45%)
Linker 97..114 0/17 (0%)
JmjC 234..297 CDD:214721 14/64 (22%)
cupin_like 269..369 CDD:304367 26/118 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.