| Sequence 1: | NP_001285579.1 | Gene: | CG3347 / 33538 | FlyBaseID: | FBgn0031513 | Length: | 538 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_085150.1 | Gene: | KDM7A / 80853 | HGNCID: | 22224 | Length: | 941 | Species: | Homo sapiens | 
| Alignment Length: | 610 | Identity: | 124/610 - (20%) | 
|---|---|---|---|
| Similarity: | 200/610 - (32%) | Gaps: | 185/610 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    11 GEADTAVSSKDVYCICRQSH-INGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTEC------ 68 
  Fly    69 --------FRKNPLLKCTYKKSPSTTGVPKTPKTPKTPKTPKN---------------------- 103 
  Fly   104 ------PKTPKTPKNSKTPKTA-----------RIINSIGVRQNPRRRSTFVQERPSEVPNPSRQ 151 
  Fly   152 STKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKN--------PKP----------EDKVTD-- 196 
  Fly   197 -DAQKPAV-------EKLFE-SKGTQCNM--FRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRY 250 
  Fly   251 CCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTN-NQKSNKNSEASESKTETKPKV 314 
  Fly   315 KKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERH---- 375 
  Fly   376 -KAKHKTSK---KEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVISSPTG 436 
  Fly   437 KKRVCRSQTISADDPLPSQPKSTEVSPMASAGTSSSNKKPVPETSCQKYRKLS----FTDENCEK 497 
  Fly   498 IKI-IRCIVS--NMSPTEKALLARK 519 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG3347 | NP_001285579.1 | PHD_SF | 23..68 | CDD:304600 | 21/45 (47%) | 
| KDM7A | NP_085150.1 | PHD_KDM7 | 39..88 | CDD:277110 | 22/48 (46%) | 
| Linker | 97..114 | 0/16 (0%) | |||
| JmjC | 234..297 | CDD:214721 | 14/63 (22%) | ||
| cupin_like | 269..369 | CDD:304367 | 25/117 (21%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 597..633 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 677..700 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 819..921 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||