DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and mbd1a

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001296818.1 Gene:mbd1a ZFINID:ZDB-GENE-030131-4214 Length:797 Species:Danio rerio

Alignment Length:225 Identity:54/226 (24%)
Similarity:85/226 (38%) Gaps:81/226 (36%)


  Fly   273 MPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSE-----------GRKSRY 326
            :||....|..:|..:.:|:.::..|.|.:      .|..|...||..|           ||.:|.
Zfish    21 VPAYLNEMHPIGEDVDSDVEDDDMSCKVT------VELLPDWLKPMEEEEVGVDELMSAGRINRR 79

  Fly   327 RSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERHKAKHKTSKKE------ 385
            ::.    |:.|.|.|...:.||::..|              ||||.::.....:|.||:      
Zfish    80 KTK----EKPPKVKRGRGRPPKIRHGL--------------SRSEFKKGLHADRTMKKKRVGSLM 126

  Fly   386 --KTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVISSPTGKKRVCRSQTISA 448
              |..|::|.|: |.||.|        :|..|.:                   ::||.||.|   
Zfish   127 SRKRLSRKATSV-PDPSLK--------AEVLPRT-------------------RQRVVRSST--- 160

  Fly   449 DDPLPSQPKSTEVSPMASAGTSSS--NKKP 476
                 |.|:||:..|.:.||.:|:  |..|
Zfish   161 -----STPQSTKQVPDSPAGGTSAEFNSPP 185

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600
mbd1aNP_001296818.1 PARM 130..>279 CDD:293666 24/93 (26%)
zf-CXXC 375..421 CDD:251032
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.