DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and kdm7a

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_017947666.1 Gene:kdm7a XenbaseID:XB-GENE-5900920 Length:923 Species:Xenopus tropicalis

Alignment Length:755 Identity:128/756 (17%)
Similarity:209/756 (28%) Gaps:318/756 (42%)


  Fly    22 VYCICRQSH-INGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYKKSPST 85
            |||:|||.: ::.|||.||.|.:|||..|:.:..:.....|.|:|.         .|.....||.
 Frog     7 VYCVCRQPYDVSRFMIECDICKDWFHSSCVKVEEHQAADIDLYHCP---------NCEVLHGPSQ 62

  Fly    86 TGVPKTPKTPKTPKTPKNPKTPKTPKNSKT----------------------------------- 115
              :.|.....:...|..:..|......::|                                   
 Frog    63 --LKKRRNWHRHDYTEPDDGTKPVQAGTRTFIQQLQARSFPSADDLLLKMNGSQLTQRYLEKQGF 125

  Fly   116 --PKTARIINSIGVRQNPRRRSTFVQER------PSEVPNPSRQS---TKLQKAVNYENATEEP- 168
              |.....::.:|:|..|...|....||      ..:|.:.:||:   .||:..|.|....:.| 
 Frog   126 NLPIMVPRLDDLGLRLPPPTFSVMDVERYVGGEKIIDVIDVARQADSKMKLKNFVKYFMNPDRPK 190

  Fly   169 -------------TEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEK--------------- 205
                         ..|..||....||.:..:|..|:|..   ..||.|:|               
 Frog   191 VLNVISLEFSDTKMADLVKVPDISKKLSWVENYWPDDSF---FTKPFVQKYCLMGVQDSYTDFHI 252

  Fly   206 -------------------LFESKGTQCNMFRDWSKYVPPEN---SKKRGTCFTVFCQQ------ 242
                               |.:.......::..||..|....   ..|...|:....:|      
 Frog   253 DFGGTSVWYHVLWGEKVFYLIKPSDENLALYESWSSSVTQSEEFFGDKVDKCYKCVVKQGHTLFV 317

  Fly   243 -----LARSCSRYCCDECGNFTAITNV------------------------------FALGLLPN 272
                 .|...|:.|....|||....|:                              .|..||..
 Frog   318 PTGWIHAVLTSQDCMAFGGNFLHNLNIGMQLRCYEMEKRLKTPDLFKFPFFEAICWFVAKNLLET 382

  Fly   273 MPAMK----------------------------------------VAMGHVGLLL---------- 287
            :..:|                                        :..||:...|          
 Frog   383 LKELKEDGFHPPNYLKHGVKALISALKSWMKKESVAEHAFEIPDNIRPGHLIKELSKVIRSVEEE 447

  Fly   288 GNDLTNNQKSNKNSEASESKTETKPKVKKPKSEGRKS-RYRSPSSSLERSPDV----SRTAAKRP 347
            ||....:|..:.:...|.|..|     |.....|||: |.|..|:....:.|:    :|...||.
 Frog   448 GNRPVKSQGIHGHCPVSRSSHE-----KSSHHSGRKARRLRDHSTKTPTNLDILEHHTREVLKRL 507

  Fly   348 KLQ--EE---------------LPSSSS-------------RSSRKLVEESR------------S 370
            ::.  ||               ||||:.             .|:.:::.:.|            |
 Frog   508 EMSPWEEDAGTYKLNMRFNKPLLPSSTEPDQKVRDNGIRLLLSNGRIIRDERQPFTDRSLYTADS 572

  Fly   371 ETERHKAKHKTSK-------------KEKTSSQRAYSL------SPIPSPKSYRAARNTSETAPN 416
            |.|..:|:.:.:|             ::|..:|:..::      |.:.:..|..:..:.||.:.:
 Frog   573 EDEDDRARSRKAKDIKQEKPCSTSGMEDKAETQKPLNMFFESVKSELRNGSSEYSDISDSEGSED 637

  Fly   417 SPVNLK----------------------------KTFKQKHVISSPTGKKRVCRSQTISADDPLP 453
            :..|.|                            :..|::|     :|::..|.......|...|
 Frog   638 NCTNQKHFSEESESSGDDDDEEEEEEEEERQEPIRNLKEEH-----SGRRLPCDPNFPWPDHDSP 697

  Fly   454 SQ---PKSTEVS--------PMASAGTSSSNKKPVPETSC 482
            .:   |.||.:.        .|||....|:...|...|.|
 Frog   698 QKRECPTSTSMEQEAVQGMLSMASLHYPSALPTPAKSTDC 737

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 18/46 (39%)
kdm7aXP_017947666.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.