DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Cxxc1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006526365.1 Gene:Cxxc1 MGIID:1921572 Length:664 Species:Mus musculus

Alignment Length:467 Identity:112/468 (24%)
Similarity:177/468 (38%) Gaps:92/468 (20%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY--KKSPS 84
            :|||||:..||.|||.|||||||||||||.:...:.:....:||.||..|:|.|:..|  ||...
Mouse    27 IYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRE 91

  Fly    85 TTGVPKTPKTPKTP----KTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSE- 144
            ..|..:....|:..    |.|.:....:....|.|...|.:...   ..:|.:.|      |.. 
Mouse    92 RDGSERAGSEPRDEGGGRKRPASDPELQRRAGSGTGVGAMLARG---SASPHKSS------PQPL 147

  Fly   145 VPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFES 209
            |..||:...:.|                ::..|:.|::|:........:.|:|.           
Mouse   148 VATPSQHHHQQQ----------------QQQQQQIKRSARMCGECEACRRTEDC----------- 185

  Fly   210 KGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNF-TAITNVFALGLLP-- 271
              ..|:..||..|:..|  :|.|..|....||..||...:|       | ::::.|.....||  
Mouse   186 --GHCDFCRDMKKFGGP--NKIRQKCRLRQCQLRARESYKY-------FPSSLSPVTPSEALPRP 239

  Fly   272 -------NMPAMKVAMGHV----GLLLGNDLTNNQKSNKNSE-ASESKTETKPKVKKPKSEGRKS 324
                   ..|.....:|.:    |.:|.:.:....::....| .|:......|.:.:....|...
Mouse   240 RRPPPTQQQPQQSQKLGRIREDEGTVLSSVVKEPPEATATPEPLSDEDLALDPDLYQDFCAGAFD 304

  Fly   325 RYRSP-SSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVE--ESRSETERHKAKHKTSKK-- 384
            .:..| .|..|.||.:.....||....:.:.....:|.:|::|  |.|.:..|.|.|||...|  
Mouse   305 DHGLPWMSDAEESPFLDPALRKRAVKVKHVKRREKKSEKKVMERKEERYKRHRQKQKHKDKWKHP 369

  Fly   385 EKTSSQRAYSLSPIPSPKSYRAARNTSETAPNS--------------PVNLKKTFKQKHVISSPT 435
            |:..::...||.....|...|||:..|:...:.              |..::: ::|...|:...
Mouse   370 ERADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQ-WQQSPCIAEEH 433

  Fly   436 GKK---RVCRSQ 444
            |||   |:.|.|
Mouse   434 GKKLLERIRREQ 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/45 (58%)
Cxxc1XP_006526365.1 PHD_Cfp1 28..73 CDD:277028 26/45 (58%)
zf-CXXC 166..212 CDD:251032 12/61 (20%)
zf-CpG_bind_C 410..644 CDD:315036 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4178
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.