DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and cxxc1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_012809846.1 Gene:cxxc1 XenbaseID:XB-GENE-5910691 Length:609 Species:Xenopus tropicalis

Alignment Length:633 Identity:136/634 (21%)
Similarity:217/634 (34%) Gaps:218/634 (34%)


  Fly    10 FGEAD-TAVSSKD------VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTE 67
            |.:|| ||....:      ||||||:..||.|||.||||||||||.||.:...:.:....:||.:
 Frog     5 FSDADLTAAGDTEDGENAPVYCICRKPDINCFMIGCDNCNEWFHGHCINITEKMAKAIREWYCVQ 69

  Fly    68 CFRKNPLLKCTY--KKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTP-----KTARI---- 121
            |..|:|.|:..|  |||.......:..:..:|.|..|......:..::|.|     ::||:    
 Frog    70 CRDKHPHLEIKYRHKKSKERERETEKDENEQTAKNEKKKSGSTSSSSNKVPRQQIKRSARMCGEC 134

  Fly   122 -----------------INSIG----VRQNPRRRSTFVQERPS---------EVP------NPSR 150
                             :...|    :||..|.|...|:.|.|         |.|      .|..
 Frog   135 EACSRTEDCGQCDFCRDMKKFGGPNKIRQKCRLRQCQVRARVSRRAPVSPGAEWPLLSAPVVPGY 199

  Fly   151 QSTKLQKAVNYEN-------ATEEP--------------------------------------TE 170
            ....|||.:..::       .|.||                                      |:
 Frog   200 SILLLQKMLRVKDDDLSLFRDTPEPSSLAGSLSDDDLPLDPELYQELCAGGAFDDHNLPWLSDTD 264

  Fly   171 DAEKVDQKPKKTA-----KKKNPKPEDKVTDDAQKPAVEK---LFESKGTQCNMFRDWSKYVPPE 227
            |...:|...:|.|     .|:..|..||..|:..|...:|   ..::|.::....||:|..    
 Frog   265 DTPFLDSVMRKRAVKVKHVKRREKKADKKKDEKYKRHKQKQRHKDKTKHSERTEIRDFSSL---- 325

  Fly   228 NSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLT 292
                 ..|....|.|.|||.|:||.|:||                   ||:|...:..:|...:.
 Frog   326 -----RQCLGPSCVQPARSSSKYCSDDCG-------------------MKLAANRIYEILPQRIQ 366

  Fly   293 NNQKSNKNSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQ------E 351
            ..|:|              |.|  .:.:|:|...|     :.|....:||     |||      .
 Frog   367 QWQQS--------------PCV--AEEQGKKLLER-----IRREQQQART-----KLQNMESRFH 405

  Fly   352 ELPSSSSRSSRKLVEESRSETE---------------RHKAKHKTSKKEKTSSQRAYSLSPIPSP 401
            ||.:..|::.::.:.|.....|               .|....|.:.:.   .:|.|        
 Frog   406 ELEALISKAKQQQIREDEETNEGDSDDTDLQIFCVSCGHPINPKVALRH---MERCY-------- 459

  Fly   402 KSYRAARNTSETAPNS--PVNLKKTFKQKHVISSPTGKKRVCRSQTI----SADDPLPSQ----- 455
                 |:..|:|:..|  |..::...:....:.:|..|....|.|.:    |.|..:|:.     
 Frog   460 -----AKYESQTSFGSMYPTRIEGATRLFCDVYNPHSKTYCKRLQVLCPEHSRDPKVPADEVCGC 519

  Fly   456 PKSTEVSPMASAGTSSSNKKPVPETSCQK---YRKLSFTDENCEKIKI 500
            |...:|..:      :.:...||:..|.:   :.||...:.:.|::::
 Frog   520 PMVKDVFEL------TGDFCRVPKRKCNRHYCWEKLRRAEVDLERVRL 561

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 24/45 (53%)
cxxc1XP_012809846.1 PHD_Cfp1 25..70 CDD:277028 24/45 (53%)
zf-CXXC 123..170 CDD:251032 7/47 (15%)
zf-CpG_bind_C 355..589 CDD:289071 43/256 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.