DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and FBXL19

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001093254.2 Gene:FBXL19 HGNCID:25300 Length:694 Species:Homo sapiens

Alignment Length:435 Identity:85/436 (19%)
Similarity:132/436 (30%) Gaps:147/436 (34%)


  Fly    11 GEADTAVSSKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIG----EQHDTYYCTECFRK 71
            |:.||....::.:.:.        ::.|..|||..|..|:.:....|    |..:.:.|..|.::
Human    95 GKEDTVEGEEEKFGLS--------LMECTICNEIVHPGCLKMGKAEGVINAEIPNCWECPRCTQE 151

  Fly    72 NPLLKCTYKKSPSTTGVPKTPKTPKTP------KTPKNPKTPKTPKNSKTPKTARIINSIGVRQN 130
            ..    |.|.|....|..:.....:..      |..:.|..|..|...|.|..|          .
Human   152 GR----TSKDSGEGPGRRRADNGEEGASLGSGWKLTEEPPLPPPPPRRKGPLPA----------G 202

  Fly   131 PRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVT 195
            |         .|.:||.|.::..:       |...|.||         |:|..|....:...||.
Human   203 P---------PPEDVPGPPKRKER-------EAGNEPPT---------PRKKVKGGRERHLKKVG 242

  Fly   196 DDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTA 260
            .||               |.:               ||:                  |..|.   
Human   243 GDA---------------CLL---------------RGS------------------DPGGP--- 256

  Fly   261 ITNVFALGLLPNM---PAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSEGR 322
                   ||||..   |:...:..|.||    ...|.:|......::|......|..::.|.|  
Human   257 -------GLLPPRVLNPSQAFSSCHPGL----PPENWEKPKPPLASAEGPAVPSPSPQREKLE-- 308

  Fly   323 KSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEE---SRSETERHKAKHKTSKK 384
              |::.....|||.||.|.:::       :..|.|..|...|.|:   ..:...|..|:..:.:|
Human   309 --RFKRMCQLLERVPDTSSSSS-------DSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGEK 364

  Fly   385 EKTSSQRA-----------YSLSPIPSPKSYRAARNTSETAPNSP 418
            |....:||           :.|.|.|.|:..:..|:.....|.||
Human   365 ENRGGRRAVRPGSGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSP 409

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 9/49 (18%)
FBXL19NP_001093254.2 zf-CXXC <50..77 CDD:251032
PHD_FXL19 87..148 CDD:277115 12/61 (20%)
F-box-like 424..465 CDD:315592
leucine-rich repeat 461..485 CDD:275381
AMN1 466..665 CDD:332986
leucine-rich repeat 486..508 CDD:275381
LRR 1 492..517
leucine-rich repeat 510..533 CDD:275381
LRR 2 518..541
leucine-rich repeat 534..573 CDD:275381
leucine-rich repeat 574..598 CDD:275381
LRR 3 581..606
leucine-rich repeat 599..623 CDD:275381
LRR 4 607..636
leucine-rich repeat 629..653 CDD:275381
LRR 5 637..661
leucine-rich repeat 654..686 CDD:275381
LRR 6 662..694
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.