| Sequence 1: | NP_001285579.1 | Gene: | CG3347 / 33538 | FlyBaseID: | FBgn0031513 | Length: | 538 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001261188.1 | Gene: | E(bx) / 44811 | FlyBaseID: | FBgn0000541 | Length: | 2761 | Species: | Drosophila melanogaster | 
| Alignment Length: | 251 | Identity: | 57/251 - (22%) | 
|---|---|---|---|
| Similarity: | 86/251 - (34%) | Gaps: | 76/251 - (30%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly    16 AVSSKDVYCICRQSHING-FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY 79 
  Fly    80 KKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSE 144 
  Fly   145 VPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFES 209 
  Fly   210 KGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVF 265 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG3347 | NP_001285579.1 | PHD_SF | 23..68 | CDD:304600 | 21/45 (47%) | 
| E(bx) | NP_001261188.1 | DDT | 190..245 | CDD:280886 | |
| WHIM1 | 288..337 | CDD:292246 | |||
| PHD1_BPTF | 341..383 | CDD:277034 | |||
| BAH | 361..>438 | CDD:295389 | |||
| TNG2 | <2423..2638 | CDD:227367 | 24/55 (44%) | ||
| PHD_SF | 2533..2579 | CDD:304600 | |||
| PHD2_3_BPTF | 2589..2635 | CDD:277035 | 21/45 (47%) | ||
| Bromo_gcn5_like | 2653..2752 | CDD:99941 | 22/151 (15%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG1632 | |
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||