DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and E(bx)

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001261188.1 Gene:E(bx) FlyBaseID:FBgn0000541 Length:2761 Species:Drosophila melanogaster

Alignment Length:251 Identity:57/252 (23%)
Similarity:86/252 (34%) Gaps:76/252 (30%)


  Fly    16 AVSSKDVYCICRQSHING-FMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY 79
            |..::.:||.|||.:... |.||||.|.:||||.|:|:..:..|..|.|.|.||.|||.......
  Fly  2582 ARETQQLYCSCRQPYDESQFYICCDKCQDWFHGRCVGILQSEAEFIDEYVCPECQRKNDANAANM 2646

  Fly    80 KKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSE 144
            ||..|                    ...:..||.             ::|....:|.:       
  Fly  2647 KKLTS--------------------NDVEELKNL-------------IKQMQLHKSAW------- 2671

  Fly   145 VPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFES 209
               |..:....::|.:|....:||. |.::::.|                   .:.....||.|.
  Fly  2672 ---PFMEPVDPKEAPDYYKVIKEPM-DLKRMEIK-------------------LESNTYTKLSEF 2713

  Fly   210 KGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITNVF 265
            .|....:|.:...|.|.|:|          ..:.|.:...|...:..||.  .|||
  Fly  2714 IGDMTKIFDNCRYYNPKESS----------FYKCAEALESYFVQKIKNFR--ENVF 2757

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 22/46 (48%)
E(bx)NP_001261188.1 DDT 190..245 CDD:280886
WHIM1 288..337 CDD:292246
PHD1_BPTF 341..383 CDD:277034
BAH 361..>438 CDD:295389
TNG2 <2423..2638 CDD:227367 25/56 (45%)
PHD_SF 2533..2579 CDD:304600
PHD2_3_BPTF 2589..2635 CDD:277035 22/46 (48%)
Bromo_gcn5_like 2653..2752 CDD:99941 23/152 (15%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.