DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and cxxc1a

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_956893.1 Gene:cxxc1a ZFINID:ZDB-GENE-040426-1142 Length:570 Species:Danio rerio

Alignment Length:620 Identity:121/621 (19%)
Similarity:219/621 (35%) Gaps:191/621 (31%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYK------ 80
            |||:||:..||.|||.||:|:||||||||.:.....:....:||.:|..|:..|:..|:      
Zfish    25 VYCVCRRPDINCFMIGCDSCSEWFHGDCIKISEKTAKTIRVWYCEKCRSKDETLEVKYRPKKSRE 89

  Fly    81 KSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARI---------------------INS 124
            |...|.|....|.||......:        :.|:..::||:                     :..
Zfish    90 KEAETDGPDTQPDTPDFKSDGR--------RGSRIKRSARMCGECEACLRTEDCGLCDFCKDMKK 146

  Fly   125 IG----VRQNPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENA--TEEPTEDAEKVDQK----- 178
            .|    :||..|.|...|:.|  ::.....:...:.|:.:|::.  :||.:|:..::.|:     
Zfish   147 FGGPNKIRQKCRLRQCEVRAR--KMLRVKEEEYSMSKSRDYQDGPLSEEYSENELELYQQYCAGQ 209

  Fly   179 ----------------------PKKTAKKKNPKPEDKVTDDAQKPAVEKLFESKGTQCNMFRDWS 221
                                  .||..|.|:.|..:|.::.::|    |..|:|.         .
Zfish   210 YGDNGTGWNSDDDDGSYGESSLRKKAVKVKHVKRREKRSEKSEK----KKEENKS---------R 261

  Fly   222 KYVPPENSKKR---------------GTCFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLP 271
            |:.|.:..:.|               ..|....|.:.||:.|:||.|:||               
Zfish   262 KHKPKQKHRDRVRHSERAEVRDSGGARQCLGPGCVEAARANSKYCSDDCG--------------- 311

  Fly   272 NMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERS 336
                ||:|...:..:|...:...|:|...:|                .:|:|...|     :.|.
Zfish   312 ----MKLAANRICEILPQRIQQWQQSPCIAE----------------EQGKKFLER-----IRRE 351

  Fly   337 PDVSR-TAAKRPKLQEELPSSSSRSSRKLVE------ESRSETE--------RHKAKHKTSKKEK 386
            ..::| ...:..|...||....:::.:::|:      |...:|:        .|....|.:.:. 
Zfish   352 QQLARMRLTEMEKRFHELEGIIAKAKQQVVQYDEEVNEGDDDTDLQIFCVSCSHSVNPKVALRH- 415

  Fly   387 TSSQRAYSLSPIPSPKSYRAARNTSETAPNS--PVNLKKTFKQKHVISSPTGKKRVCRSQTI--- 446
              .:|.|             |:..|:|:..|  |..::...:....:.:|..|....|.|.:   
Zfish   416 --MERCY-------------AKYESQTSFGSMYPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPE 465

  Fly   447 -SADDPLPSQ-----PKSTEVSPMASAGTSSSNKKPVPETSCQK---YRKLSFTDENCEKIKIIR 502
             |.|..:|:.     |...:|..........|.:|      |.|   :.||...:.:.|::::..
Zfish   466 HSRDPKIPADEVCGCPLVRDVFEPTGEYCRVSKRK------CNKHYCWEKLRRAEVDLERVRVWY 524

  Fly   503 CI--VSNMSPTEKALLARKRMMMKLASEQHIRQAP 535
            .:  :.......|..:..:..:|.|...|.|:..|
Zfish   525 KLDELFEQERNVKTAMTNRAGLMALMPHQTIQHDP 559

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 22/45 (49%)
cxxc1aNP_956893.1 PHD_SF 26..71 CDD:304600 22/45 (49%)
zf-CXXC 115..162 CDD:251032 7/47 (15%)
zf-CpG_bind_C 317..550 CDD:289071 43/276 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.