DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Dido1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006224832.1 Gene:Dido1 RGDID:1311173 Length:2258 Species:Rattus norvegicus

Alignment Length:670 Identity:146/671 (22%)
Similarity:214/671 (32%) Gaps:235/671 (35%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIG----EQHDTYYCTECF------------- 69
            :||||||.|.|.||||||.|.|||||||:|:....|    ...:.|.|..|.             
  Rat   266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNCTILQVQDETSSSAA 330

  Fly    70 ---------------------------------------RKNPLLK------------------- 76
                                                   ..||..|                   
  Rat   331 DEQDAGCRPVGADGTDCTSIGTVEQRSGEDQGIKGRIEKAANPSGKKKLKIFQPVVEAPGAAKCI 395

  Fly    77 ------------------CTYKKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPK---TAR 120
                              |..|.:.:|..:..:.|..| || ||. |....|:....||   .|.
  Rat   396 GPGCSNVAQPDSVYCSNDCILKHAAATMKILSSGKEQK-PK-PKE-KVKMKPEKFSLPKCSVQAG 457

  Fly   121 I-INSI------GVRQNPRRRSTFVQ----------------------------ERPSEVPNPSR 150
            | |:|:      ..|:||.::.|...                            |:|.:...|:.
  Rat   458 IKISSVHKRLASEKRENPVKKVTLASRSETSVKEATCESTPSWASDHNYNAVKPEKPEKPEKPTA 522

  Fly   151 QS-TKLQKAVNYENATEEPTEDAEKVDQK-------------PKKTAKKKNPKPEDKVTDDAQKP 201
            .| |.|.|::..:...|:.|..|..|.:|             |:....||.| |...:.  ..|.
  Rat   523 LSPTLLSKSMKDDKRVEDRTVAAAAVPKKAVPPGSVMGRQTSPRNLVPKKLP-PYPNMA--GAKT 584

  Fly   202 AVEKLFES-KGTQCNMFRDW-SKYVPPENSKKRG-TCFTVFCQQLARSCSRYCCDECGNFTAITN 263
            ||:||... |||...  |.| |..:...::::.| |......::|..|            .|:..
  Rat   585 AVKKLPSGFKGTIPK--RPWPSATLSGTSARQAGPTPVIAASKKLPGS------------AAVVG 635

  Fly   264 VFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEA------------SESKTETKPKVKK 316
            :....:..|:||.....|.:|.:.......|.:..:|...            |:....|:.:|.|
  Rat   636 IARKPMSANVPAASPVPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEVGK 700

  Fly   317 -------------PKSEGR-KSRYRSPSSSLERSP------------DVSRTAAKRPKLQEELPS 355
                         ..::.| ||:|||...:| :.|            ::|.....|.| .|||.|
  Rat   701 IALHIEKEMFNLFQVTDNRYKSKYRSIMFNL-KDPKNQGLFHRVLREEISLAKLVRMK-PEELVS 763

  Fly   356 SS----SRSSRKLVEESRSETERHKAKHKTSKKEKTSSQRAYSLSPIPSPKSYRAARNTSETAPN 416
            ..    :....|.|.|||::......|:.|..:.....:.:..:|.....:|.|||...| |||.
  Rat   764 KELSMWTEKPTKSVIESRTKLLNESKKNSTKPETIPDMEDSPPVSDSEEQESVRAAPEKS-TAPL 827

  Fly   417 SPV---NLKKTFKQ--KHVISSPTGKKRVCRSQTISA-DDPLPSQPKSTEVS------------- 462
            ..|   .||.|..|  .|:...   ..::|..|..|: |:|.|.:.|.:..|             
  Rat   828 LDVFSSMLKDTTSQHRAHLFDL---NCKICTGQVPSSEDEPAPKKQKLSASSKKEDLKARHDSSP 889

  Fly   463 PMASAGTSSSNKKPVPETSC 482
            |.|...|:.......||.:|
  Rat   890 PDAVPSTADEGIAETPENTC 909

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/49 (53%)
Dido1XP_006224832.1 IBB 138..241 CDD:280005
CDC45 <143..>192 CDD:280821
PHD_DIDO1_like 263..316 CDD:277109 26/50 (52%)
TFS2M 671..772 CDD:128786 20/103 (19%)
SPOC 1054..1160 CDD:285043
SWIRM-assoc_1 <1464..1502 CDD:293104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.