DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and cxxc1b

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_956627.1 Gene:cxxc1b ZFINID:ZDB-GENE-030728-4 Length:563 Species:Danio rerio

Alignment Length:559 Identity:115/560 (21%)
Similarity:204/560 (36%) Gaps:149/560 (27%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYKKSPSTT 86
            :|||||:|.||.|||.||||||||||.||.:...:.:....:||.:|..::|.|...|:|.    
Zfish    26 LYCICRKSDINCFMIGCDNCNEWFHGHCINVTEKMAKAIREWYCQQCRARDPSLSIRYRKK---- 86

  Fly    87 GVPKTPKTPKTPKTPKNPKTPK----TPKNSKTPKTARI---------------------INSIG 126
               ...|..:..:..|...||:    ..:.||..::||:                     :...|
Zfish    87 ---NRDKDVEPERVEKRSSTPEYKIDKRRGSKVKRSARMCGECEPCTRTEDCGHCDFCKDMKKFG 148

  Fly   127 ----VRQNPRRRSTFVQE------RPSEVPNPSRQSTKLQKAVNYENATEE-------------- 167
                :||..|.|...|:.      |..|.....|:...:.:...|.:..:|              
Zfish   149 GPNKIRQKCRLRQCVVRARKMLRVRDEEFSLRERKDNIMHRDRRYSDDYDENDMDLYEHYKDRNA 213

  Fly   168 ----PTEDAEKVDQKPKKTA-KKKNPKPEDKVTDDAQKPAVEKLFESKGTQCNMFRDWSKYVPPE 227
                ..:|.:.....|:|.| |.|:.|..||..|..::....|       |....||..::....
Zfish   214 SWGSEDDDGQLYSPVPRKKAIKVKHVKRRDKKFDKKKESRRHK-------QKQKHRDRLRHSDRT 271

  Fly   228 NSKKRG---TCFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGN 289
            :.:..|   .|....|.:.||..|:||.::||                   ||:|...:..:|..
Zfish   272 DGRHGGDTQQCLGPNCIEPARPNSKYCSEDCG-------------------MKLAANRIYEVLPQ 317

  Fly   290 DLTNNQKSNKNSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELP 354
            .:...|:|...:|     .:.|.::::.:.|.:.:|.|               .|:..:...||.
Zfish   318 RIQQWQQSPCIAE-----EQGKKQLERIRREQQAARMR---------------LAEMERRFHELE 362

  Fly   355 SSSSRSSRKLV--EESRSETE-------------RHKAKHKTSKKEKTSSQRAYSLSPIPSPKSY 404
            ...:::.::||  :|..:||:             .|....|.:.:.   .:|.|           
Zfish   363 GIIAKAKQQLVLQDEDVNETDSEDTDLQIFCVSCSHPVNPKVALRH---MERCY----------- 413

  Fly   405 RAARNTSETAPNS--PVNLKKTFKQKHVISSPTGKKRVCRSQTISADDPLPSQPKSTEV--SPMA 465
              |:..|:|:..|  |..::...:....:.:|..|....|.|.:..:.....:..|.||  .|:.
Zfish   414 --AKYESQTSFGSIFPTRIEGATRLFCDVYNPQSKTYCKRLQVLCPEHSRDPKVTSDEVCGCPLV 476

  Fly   466 -SAGTSSSNKKPVPETSCQK---YRKLSFTDENCEKIKI 500
             :....:.:...|.:..|.|   :.||...:.:.|::::
Zfish   477 RNVFDPTGDYCRVSKRKCNKHYCWEKLRRAEVDLERVRV 515

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 25/45 (56%)
cxxc1bNP_956627.1 PHD_Cfp1 27..72 CDD:277028 25/45 (56%)
zf-CXXC 115..162 CDD:251032 8/47 (17%)
zf-CpG_bind_C 309..543 CDD:289071 39/244 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.