DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and bptf

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_009297692.1 Gene:bptf ZFINID:ZDB-GENE-030131-3200 Length:2900 Species:Danio rerio

Alignment Length:603 Identity:110/604 (18%)
Similarity:198/604 (33%) Gaps:185/604 (31%)


  Fly    60 HDTYYCTECFRKNPLLKCTYKK-SPSTTG--------------------VPKTPKT-PKTPKTPK 102
            ||....:|.|    |.:..||| .||...                    :.:.|.: |.|....:
Zfish  1128 HDVVNVSEGF----LQRTAYKKLKPSKLDGLLERRVKQFTIEEKQRIDKLKQAPTSKPLTETAVE 1188

  Fly   103 NPKT---------------PKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSEVPNPSRQS 152
            |.:|               .:|||..:|...|.:  :|..:.|..:|..|.||......|.|.|.
Zfish  1189 NKETTLAAQDHKVKIEGTISETPKARQTEGVACL--AIQEKDNVVKRLVFNQEDEQAKTNTSGQK 1251

  Fly   153 TKLQKAVNYENATEEPTEDAEKVDQKPKKTAKK------------------KNPKPEDKVT---- 195
            ..|...:| ::....|.|:.:|:.:...|||.:                  .|.||:..:|    
Zfish  1252 NTLDVRLN-DSVELAPKENQQKLAETDPKTASRVAMSELNGNSQSLDQSLSLNAKPDKNITEATC 1315

  Fly   196 ---DDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGN 257
               |.|.|..:|      .::.::  |..|.||.:.:.|..|                ...||.|
Zfish  1316 PPEDSAGKDNIE------NSENDL--DVKKTVPVQVNGKDVT----------------VDPECKN 1356

  Fly   258 FT------AITNVFA---LGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPK 313
            .|      .:||...   ..:.|..|...:..|........:.||:.....|.:..::.|:..|.
Zfish  1357 LTDNGDTKELTNTIVEDIKAISPKEPVKSLMNGDATQECLKEWTNSTIPQVNLDEEKAVTKLDPD 1421

  Fly   314 VKKPKSEGR-KSRYRSP-SSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSETERHK 376
            ...|:...: ::....| .||:..|.......|..|..:.|:||.||:.....|.|::....   
Zfish  1422 YPPPQKVAKLENNIEKPIDSSVSLSVPEPSPVASEPNERSEVPSHSSKVEPMQVVEAKPSVP--- 1483

  Fly   377 AKHKTSKKEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVISSPTGKKRVC 441
                               ||:||.:....:.:.:|.:.    ::.:|.....|.::.|......
Zfish  1484 -------------------SPVPSAEESSLSSDLTENSS----SIGETTVVTQVTTTTTTVSTES 1525

  Fly   442 RSQTISADDPLPSQ-------------PKSTEVSPMASAGTS------SSNKKPVPETSCQKYRK 487
            | ..:::.|.|.|:             ..|:.||.::|..|:      ||:::....|.|:....
Zfish  1526 R-MVLTSRDSLASKNGLNTAVLTDSKVESSSSVSTLSSTTTTTVTKVLSSSQEATLTTECKTMVM 1589

  Fly   488 LSFTDENC-------------------EKIKIIRCIVSNMSPTEKALLARKRM------------ 521
            .:.||...                   :::::::...:..:.:..||.:.::.            
Zfish  1590 KTLTDTTSSPSGSTVKSMTVSHEYSTRDRVRLLKFSRTKKTRSGTALPSYRKFVTKSSKKSIFVL 1654

  Fly   522 ----MMKLASEQHIRQAP 535
                :.|||....||:.|
Zfish  1655 PNDELKKLARRGGIREVP 1672

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 3/8 (38%)
bptfXP_009297692.1 DDT 198..254 CDD:280886
WHIM1 296..345 CDD:292246
PHD1_BPTF 349..391 CDD:277034
WHIM2 414..439 CDD:292247
PP28 <1833..1881 CDD:287254
PHD2_3_BPTF 2665..2711 CDD:277035
PHD2_3_BPTF 2723..2769 CDD:277035
Bromo_gcn5_like 2785..2885 CDD:99941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.