DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Cfp1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_572556.1 Gene:Cfp1 FlyBaseID:FBgn0030121 Length:663 Species:Drosophila melanogaster

Alignment Length:554 Identity:122/555 (22%)
Similarity:195/555 (35%) Gaps:121/555 (22%)


  Fly    15 TAVSSKD-VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCT 78
            |.:..:| .|||||.|..:.|||.||.|.||:||||||:.....:....|||..|.::||.|:..
  Fly    53 TILKQEDQAYCICRSSDCSRFMIGCDGCEEWYHGDCIGITEKEAKHIKQYYCRRCKKENPELQTI 117

  Fly    79 YKKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPS 143
            ::       :..|.:...:.....:...|....:...|..|.:.::...:|.|...:...:.:  
  Fly   118 FR-------LVATERAAASNAASTSLNAPGVGPSGAAPAAAPVASATTSQQAPPPTTAAAKRK-- 173

  Fly   144 EVPNPSRQSTKLQKAVNYENATEEPT---EDA--EKVDQKPKKTAKKKNPKPEDKVTDDAQKPAV 203
               |.|.:..|:.|..........|.   .||  .:|..||:...:          |...|...|
  Fly   174 ---NSSAREPKMGKRCGTCEGCRRPNCNQCDACRVRVGHKPRCIFR----------TCVVQAATV 225

  Fly   204 EKLFESKGTQCNMFRDWSKYVP-------------PE---NSKKRG--TCFTVFCQQLARSCSRY 250
            .|  ||:.||....|...|..|             ||   |.:.:|  .|:...|...||..|:|
  Fly   226 LK--ESQATQAGPSRKREKAAPKSRNVQVGPRAASPEIFLNPELQGIRQCYGPNCCSHARPQSKY 288

  Fly   251 CCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVK 315
            |.|:||...|...:|.  :||                      .:....|...|.:..||:..:.
  Fly   289 CSDKCGFNLATKRIFQ--VLP----------------------QRLQEWNLTPSRAAEETRKHLD 329

  Fly   316 KPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEESRSE--TERHKAK 378
            ..:.  ::|..|...:.||:..:......:|.| :..:.:..|:.:..:.:|....  |..|:..
  Fly   330 NIRH--KQSLVRFALAELEKRSEELNMVVERAK-RSSIDTLGSQDTADMEDEQSMYCITCGHEIH 391

  Fly   379 HKTSKKEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKHVISSPTGKKR---V 440
            .:|:.|........|.     |..|:.:...|.....|       .|...:..:|.|..||   :
  Fly   392 SRTAIKHMEKCFNKYE-----SQASFGSIFKTRMEGNN-------MFCDFYNPASKTYCKRLRVL 444

  Fly   441 CRSQTISADDPLPSQPKSTEVSPMASAGTSSSNK--KPVPETSCQKYRKLSFTDENCEKIKIIRC 503
            |           |...|..:|:.....|:...|.  .|..| .|:..:|..|.....|||:  |.
  Fly   445 C-----------PEHSKDPKVNDTDVCGSPLVNNVFNPTGE-FCRAPKKNCFKHYAWEKIR--RA 495

  Fly   504 IVSNMSPTEKALLARKRMMMK----LASEQHIRQ 533
            .:.         |.|.|..:|    :..|:.:||
  Fly   496 EID---------LERVRQWLKMDDLMEQERVMRQ 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 23/45 (51%)
Cfp1NP_572556.1 PHD_Cfp1 62..107 CDD:277028 23/45 (51%)
zf-CXXC 178..218 CDD:251032 9/50 (18%)
zf-CpG_bind_C 300..532 CDD:289071 51/284 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4178
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46174
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
65.990

Return to query results.
Submit another query.