DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and CG17440

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_572555.1 Gene:CG17440 FlyBaseID:FBgn0030120 Length:366 Species:Drosophila melanogaster

Alignment Length:376 Identity:89/377 (24%)
Similarity:144/377 (38%) Gaps:98/377 (26%)


  Fly    15 TAVSSKD-VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCT 78
            |.:..|| .|||||.|..:.|||.||.|.||:|||||.:.....|....|||..|.::||.|:..
  Fly    31 TILKQKDREYCICRSSDCSRFMIGCDGCEEWYHGDCIEITEKDAEHIKNYYCRRCKKENPELQTI 95

  Fly    79 YK----------KSPSTT----GVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQ 129
            ::          .:.||:    ||..:...|..  .|..|.|  |.:.:..|.||.         
  Fly    96 FRLVATERAAASNAASTSLNAPGVGPSGAAPAA--APVAPAT--TSQQAPPPTTAA--------- 147

  Fly   130 NPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKV 194
             .:|:::..|| |.| ..|::..||..||.                   ||.:..:.:|:     
  Fly   148 -AKRKNSSAQE-PKE-SQPTQAGTKRDKAA-------------------PKTSNVQVSPR----- 185

  Fly   195 TDDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFT 259
               |..|.:....|.:|.|                    .|....|...||..|:||.||||:..
  Fly   186 ---AVSPEIFLNPELQGIQ--------------------QCHGPNCCSHARPQSKYCSDECGSNL 227

  Fly   260 AITNVFAL--------GLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKK 316
            ||..:|.:        .:.|:..|.:... |:.|.:...:...|:..:..|....:.:|:.|..:
  Fly   228 AIERLFQILPQQMQEWNITPSRAAEETRK-HLELNMDELVLKQQEQLEEFEKQRQQIQTQQKQYQ 291

  Fly   317 PKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEE 367
            .|.:          ..|::.|. .:...:..:.|:||.....:..::|:::
  Fly   292 EKQK----------LMLQQQPQ-QQQQQQELQQQQELQQQQEQEQQQLLQQ 331

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 23/45 (51%)
CG17440NP_572555.1 PHD_Cfp1 40..85 CDD:277028 23/45 (51%)
zf-CpG_bind_C 231..>278 CDD:289071 7/48 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002408
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR46174
RoundUp 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.