DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and CXXC1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_001095124.1 Gene:CXXC1 HGNCID:24343 Length:660 Species:Homo sapiens

Alignment Length:485 Identity:114/486 (23%)
Similarity:175/486 (36%) Gaps:132/486 (27%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY--KKSPS 84
            :|||||:..||.|||.|||||||||||||.:...:.:....:||.||..|:|.|:..|  |||..
Human    27 IYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKSRE 91

  Fly    85 TTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSEVPNP- 148
            ..|               |.:....|::..           |.|:.|             ||:| 
Human    92 RDG---------------NERDSSEPRDEG-----------GGRKRP-------------VPDPD 117

  Fly   149 ---------------SRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDA 198
                           :|.|....|: :.:.....|::..::..|:.|::|:........:.|:|.
Human   118 LQRRAGSGTGVGAMLARGSASPHKS-SPQPLVATPSQHHQQQQQQIKRSARMCGECEACRRTEDC 181

  Fly   199 QKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTAITN 263
                         ..|:..||..|:..|  :|.|..|....||..||...:|             
Human   182 -------------GHCDFCRDMKKFGGP--NKIRQKCRLRQCQLRARESYKY------------- 218

  Fly   264 VFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKNSE---ASESKTETKP----KVKKPKSE- 320
             |...|.|..|:..:......|........:||..:..|   |..|.|..:|    ...:|.|: 
Human   219 -FPSSLSPVTPSESLPRPRRPLPTQQQPQPSQKLGRIREDEGAVASSTVKEPPEATATPEPLSDE 282

  Fly   321 --------------GRKSRYRSP-SSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVE--ES 368
                          |....:..| .|..|.||.:.....||....:.:.....:|.:|::|  |.
Human   283 DLPLDPDLYQDFCAGAFDDHGLPWMSDTEESPFLDPALRKRAVKVKHVKRREKKSEKKVMERKEE 347

  Fly   369 RSETERHKAKHKTSKK--EKTSSQRAYSLSPIPSPKSYRAARNTSETAPNS-------------- 417
            |.:..|.|.|||...|  |:..::...||.....|...|.|:.:|:...:.              
Human   348 RYKRHRQKQKHKDKWKHPERADAKDPASLPQCLGPGCVRPAQPSSKYCSDDCGMKLAANRIYEIL 412

  Fly   418 PVNLKKTFKQKHVISSPTGKK---RVCRSQ 444
            |..::: ::|...|:...|||   |:.|.|
Human   413 PQRIQQ-WQQSPCIAEEHGKKLLERIRREQ 441

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/45 (58%)
CXXC1NP_001095124.1 PHD_Cfp1 28..73 CDD:277028 26/45 (58%)
zf-CXXC 162..208 CDD:251032 12/61 (20%)
zf-CpG_bind_C 406..640 CDD:315036 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S4178
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.