DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Cxxc1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006254979.1 Gene:Cxxc1 RGDID:1310755 Length:664 Species:Rattus norvegicus

Alignment Length:465 Identity:111/466 (24%)
Similarity:178/466 (38%) Gaps:88/466 (19%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTY--KKSPS 84
            :|||||:..||.|||.|||||||||||||.:...:.:....:||.||..|:|.|:..|  ||...
  Rat    27 IYCICRKPDINCFMIGCDNCNEWFHGDCIRITEKMAKAIREWYCRECREKDPKLEIRYRHKKCRE 91

  Fly    85 TTGVPKTPKTPKTP----KTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQERPSEV 145
            ..|..:....|:..    |.|.:....:....|.|...|.:...   ..:|.:.|    .:|. |
  Rat    92 RDGSERDGSEPRDEGGGRKRPASDPELQRRAGSGTGVGAMLARG---SASPHKSS----PQPL-V 148

  Fly   146 PNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFESK 210
            ..||:...:.|:               ::..|:.|::|:........:.|:|.            
  Rat   149 ATPSQHHQQQQQ---------------QQQQQQIKRSARMCGECEACRRTEDC------------ 186

  Fly   211 GTQCNMFRDWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNF-TAITNVFALGLLP--- 271
             ..|:..||..|:..|  :|.|..|....||..||...:|       | ::::.|.....||   
  Rat   187 -GHCDFCRDMKKFGGP--NKIRQKCRLRQCQLRARESYKY-------FPSSLSPVTPSEALPRPR 241

  Fly   272 ------NMPAMKVAMGHV----GLLLGNDLTNNQKSNKNSE-ASESKTETKPKVKKPKSEGRKSR 325
                  ..|.....:|.:    |.:|.:.:....::....| .|:......|.:.:....|....
  Rat   242 RPPPTQQQPQQSQKLGRIREDEGTVLSSVVKEPPEATATPEPLSDEDLALDPDLYQDFCAGAFDD 306

  Fly   326 YRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVE--ESRSETERHKAKHKTSKK--EK 386
            :....|..|.||.:.....||....:.:.....:|.:|::|  |.|.:..|.|.|||...|  |:
  Rat   307 HVPWMSDAEESPFLDPALRKRAVKVKHVKRREKKSEKKVMERKEERYKRHRQKQKHKDKWKHPER 371

  Fly   387 TSSQRAYSLSPIPSPKSYRAARNTSETAPNS--------------PVNLKKTFKQKHVISSPTGK 437
            ..::...||.....|...|||:..|:...:.              |..::: ::|...|:...||
  Rat   372 ADAKDPASLPQCLGPGCVRAAQPGSKYCSDDCGMKLAANRIYEILPQRIQQ-WQQSPCIAEEHGK 435

  Fly   438 K---RVCRSQ 444
            |   |:.|.|
  Rat   436 KLLERIRREQ 445

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/45 (58%)
Cxxc1XP_006254979.1 PHD_Cfp1 28..73 CDD:277028 26/45 (58%)
zf-CXXC 167..213 CDD:251032 12/61 (20%)
zf-CpG_bind_C 410..644 CDD:289071 9/38 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D463371at2759
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.