DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and set3

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_594837.1 Gene:set3 PomBaseID:SPAC22E12.11c Length:859 Species:Schizosaccharomyces pombe

Alignment Length:583 Identity:120/584 (21%)
Similarity:208/584 (36%) Gaps:146/584 (25%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECFRKNPLLKCTYKKSPSTT 86
            :.|:|.....:||.|.|::|..|.|..|:.:.||  ...:.|:|.:|             .|...
pombe     4 IRCVCPFEDDDGFTIQCESCEVWQHAVCVNIDAN--NVPEKYFCEQC-------------QPRPI 53

  Fly    87 GVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQE--RPSEVPNPS 149
            ...|..|.             :..:..:..:.:||: |.....|.:||::|.:.  .|:...:|.
pombe    54 DADKAHKI-------------QLARLQREEEQSRIL-SRSRSSNNKRRTSFGKNGASPTHSASPR 104

  Fly   150 R------------QSTKLQKAVNYENATEE---PTEDAEKVDQKPKKTAKKKNPKPEDKVTDDAQ 199
            :            |||....:.:|.|:...   |...|.....:.:::....|| ||..:|:.:.
pombe   105 QGNNTGANGALFSQSTNSSNSGSYRNSVTGATLPNAHAPHSQNRRRRSNHLNNP-PEAPITEASN 168

  Fly   200 KPAVEKLFESKGTQCNMFR----DWSKYVPPENSKKRGTCFTVFCQQLARSCSRYCCDECGNFTA 260
            :.......|....:.|.|.    ::||.:..:|..:...... .||.:..|.|::||...|    
pombe   169 EYVYSFHLEYVPLESNTFSASALEYSKNLDLKNLDESEVLMD-GCQVVPISSSKFCCSRFG---- 228

  Fly   261 ITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQ-KSNKNSE-------------ASESKTETK 311
              .|....:.||.|.|:|.        |...|.|: ||:..::             .|.|:....
pombe   229 --LVSTCEIPPNTPIMEVK--------GRVCTQNEYKSDPKNQYNILGAPKPHVFFDSNSQLVVD 283

  Fly   312 PKVKKPKSE-GRK---------SRYRSPSSSLER---------SP----------DVSR------ 341
            .:|...|:. .||         |.|.:.|:|:.|         :|          |:|.      
pombe   284 SRVAGSKARFARKGCQSNSVVSSVYMNGSNSVPRFILYSTTHIAPETEIIGDWTLDISHPFRQFA 348

  Fly   342 TAAKRPKL-QEELPSSSSRSSRKL-VEESRSETERH----------KAKHKTSKKEKTS-SQRAY 393
            ....||.. .|||...|...|..| ..|..|:.:::          ||..:.|...:.| ::...
pombe   349 PGMSRPSFNMEELELLSEVLSTFLSFNECASQDKKNCVFSRVTKYIKAARRASTANRVSVAKDRL 413

  Fly   394 SLSPIPSPKSYRAARNTSETAPNSPVNL-KKTFKQKHVISSPTGKKRVCRSQTISADDPLPSQPK 457
            ||:|..:|.:...|.:..:  |::|.:: .|:.|:..:     .|.|:...|...|...||::..
pombe   414 SLTPSSTPSTPSPAESLPQ--PSNPTSVYAKSLKEFWL-----DKYRLSILQKWPAVKSLPTESV 471

  Fly   458 STEVSPMASAGTSSSNKKP----------VPETSCQKYRKLSFTDENCEKIKIIRCIVSNMSP 510
            ..:|........|...|||          |.|.|..:.:|....|.:.:....|..::|.:||
pombe   472 GIDVVMEPKLQPSVKEKKPTKDLQSPLPSVEEDSSNRDKKTDIADLHTDSKVGIADVLSPISP 534

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 14/45 (31%)
set3NP_594837.1 PHD_MLL5 5..48 CDD:277025 14/45 (31%)
SET 215..343 CDD:214614 30/142 (21%)
SET 284..826 CDD:225491 55/259 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 76 1.000 Inparanoid score I1853
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.