DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and spf1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_587791.1 Gene:spf1 PomBaseID:SPCC594.05c Length:424 Species:Schizosaccharomyces pombe

Alignment Length:287 Identity:61/288 (21%)
Similarity:101/288 (35%) Gaps:92/288 (32%)


  Fly    15 TAVSSKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQHDTYYCTECF---------- 69
            ||...:.:||||::.....:|:.||.|.:||||.|:.:|.:..:....|:|.:|.          
pombe   112 TADHQRPLYCICQKPDDGSWMLGCDGCEDWFHGTCVNIPESYNDLTVQYFCPKCTEEGKGITTWK 176

  Fly    70 RKNPLLKCTYKKSPSTT------GV----PKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINS 124
            ||..|.:|:....|::.      ||    .|...:...|...||                 ::..
pombe   177 RKCRLRECSNPTRPNSNYCSDKHGVDFFREKVKLSTVEPSAIKN-----------------LVLF 224

  Fly   125 IGVRQNPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTEDAEKVDQKPKKTAKKKNPK 189
            ...|:..:...|.....||:||.        :...|:|      .|:|.:::.:..:..|:|...
pombe   225 AKKREEFQNLGTVGPTLPSQVPP--------EVVYNFE------IEEANRLNAEIVQLNKEKEVA 275

  Fly   190 PEDKV----TDDAQKPAVEKLFESKG--------------TQCNMFRDWSKY---VP-------- 225
            ...|:    ..|:.:.||....|.:|              .|..|...|.|.   .|        
pombe   276 SNKKIFLQLIKDSSRRAVLAYKEREGIKKDLCGFDSRLLFNQQQMNELWEKVSNGAPLSLDMSID 340

  Fly   226 --PENSKKRGTCFTVFCQQLARSCSRY 250
              ||:     ||||.     .|.|:::
pombe   341 PSPES-----TCFTE-----KRRCAKH 357

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 16/45 (36%)
spf1NP_587791.1 PHD_SPP1 120..165 CDD:277186 16/45 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002408
OrthoInspector 1 1.000 T631737
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR46174
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1383
TreeFam 00.000 Not matched by this tool.
44.130

Return to query results.
Submit another query.