DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Dido1

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:NP_780760.2 Gene:Dido1 MGIID:1344352 Length:2256 Species:Mus musculus

Alignment Length:718 Identity:142/719 (20%)
Similarity:219/719 (30%) Gaps:302/719 (42%)


  Fly    22 VYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIG----EQHDTYYCTECFRKNPLLK------ 76
            :||||||.|.|.||||||.|.|||||||:|:....|    ...:.|.|..|    .:|:      
Mouse   266 LYCICRQPHNNRFMICCDRCEEWFHGDCVGISEARGRLLERNGEDYICPNC----TILQVQDETN 326

  Fly    77 --------------------CT-----YKKSPSTTGV-------------------------PKT 91
                                ||     .:||....|:                         |..
Mouse   327 GSATDEQDSGCRSVGADGTDCTSIGTVEQKSGEDQGIKGRIEKAANPSGKKKLKIFQPVVEAPGA 391

  Fly    92 PK----------------------------------TPKTPKTPKNPKTPKTPKNSKTPKTARII 122
            ||                                  :.|..||....|....|:....||.:   
Mouse   392 PKCIGPGCSSVAQPDSVYCSNDCILKHAAATMRFLSSGKEQKTKPKEKVKTKPEKFSLPKCS--- 453

  Fly   123 NSIGV-------------RQNP-------RRRSTFVQERPSEVPNPSRQS--------------- 152
            ..:|:             |:||       .|..|..:|...|...||..|               
Mouse   454 VQVGIKISSVHKRLASEKRENPVKKVMLASRSETSGKEAACESSTPSWASDHNYNAVKPEKPEKP 518

  Fly   153 -----TKLQKAVNYENATEEPTEDAEKVDQK-------------PKKTAKKKNPKPEDKVTDDAQ 199
                 |.|.|::..:...|:.|..|..:.:|             |:....||.| |...:.  ..
Mouse   519 TALSPTLLSKSMKDDRRVEDRTMAAVTIPKKALPSASLVGRQTSPRNLVPKKLP-PYSNMA--GA 580

  Fly   200 KPAVEKLFES-KGTQCNMFRDW-SKYVPPENSKKRG-TCFTVFCQQLARSCSRYCCDECGNFTAI 261
            |||::||... |||...  |.| |..:...::::.| |..|...::|..|            .|:
Mouse   581 KPAIKKLPSGFKGTIPK--RPWPSATLSGTSARQAGPTPMTAASKKLPGS------------AAV 631

  Fly   262 TNVFALGLLPNMPAMKVAMGHVGLLLG-------------------------ND-----LTNN-- 294
            ..|....:..|:||...|.|.:|.:..                         ||     :|.|  
Mouse   632 VGVTRKPMSANVPAASPAPGRLGPVSPAPSQPNSQIRQNIRRSLKEILWKRVNDSDDLIMTENEV 696

  Fly   295 -------QKSNKN-SEASESKTETKPK-----VKKPKSEGRKSRYRSPSSSLER----SPDVSRT 342
                   :|...| .:.::::.::|.:     :|.||::|...|......||.:    .|:  ..
Mouse   697 GKIALHIEKEMFNLFQVTDNRYKSKYRSIMFNLKDPKNQGLFHRVLREEISLAKLVRMKPE--EL 759

  Fly   343 AAKRPKLQEELPSSSSRSSR-KLVEESRSETER-----------------------HKAKHKTSK 383
            .:|...:..|.|:.|...|| ||:.||:..|.:                       ..|..|::.
Mouse   760 VSKELSMWTEKPTKSVIESRTKLLNESKKNTTKPETIPDMEDSPPVSDSEEQQESVRAAPEKSAA 824

  Fly   384 ----------KEKTSSQRAY--------------SLSPIPSPKSYRAARNTSETAPNSPVNLKKT 424
                      |:.||..||:              |....|:||..:.:.::.          |:.
Mouse   825 PLLDVFSSMLKDTTSQHRAHLFDLNCKICTGQVPSSEDEPAPKKQKLSASSK----------KED 879

  Fly   425 FKQKHVISSP-----TGKKRVCRSQTISADDP--------------LPSQPKSTEVSPMASAGTS 470
            ||.:|..|.|     |..:.:..:...:|.:|              .|..|..:...|.:..|.|
Mouse   880 FKPRHDSSPPNAVPNTADEGIADTLPENASEPDPESTSSLNQERKCFPESPGDSHPEPSSLGGLS 944

  Fly   471 SSN 473
            .|:
Mouse   945 PSS 947

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 26/49 (53%)
Dido1NP_780760.2 TNG2 <157..299 CDD:227367 23/33 (70%)
Nuclear localization signal. {ECO:0000255} 162..170
Nuclear localization signal. {ECO:0000255} 182..190
PHD_DIDO1_like 263..316 CDD:277109 26/50 (52%)
TFS2M 669..770 CDD:128786 17/103 (17%)
SPOC 1052..1158 CDD:285043
SWIRM-assoc_1 <1461..1499 CDD:293104
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.