DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Fbxl19

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006507816.1 Gene:Fbxl19 MGIID:3039600 Length:696 Species:Mus musculus

Alignment Length:436 Identity:85/437 (19%)
Similarity:129/437 (30%) Gaps:149/437 (34%)


  Fly    11 GEADTAVSSKDVYCICRQSHINGFMICCDNCNEWFHGDCIGLPANIGE-QHDTYYCTECFRKNPL 74
            |:.||.....:.:.:.        ::.|..|||..|..|:.:....|. ..:...|.||      
Mouse    97 GKEDTVEGEDEKFSLS--------LMECTICNEIVHPGCLKMGKAEGVINSEIPNCWEC------ 147

  Fly    75 LKCTYKKSPSTTGVPKTPKTPKTPKTPKNPKTPKTPKNSKTPKTARIINSIGVRQNPRRRSTFVQ 139
                                            |:..:..:|.|.|        .:.|.||     
Mouse   148 --------------------------------PRCTQEGRTSKDA--------GEGPGRR----- 167

  Fly   140 ERPSEVPNPSRQSTKLQKAVNYENA---------TEEPTEDAEKVDQKPKKTAKKKNPKPEDKVT 195
                             :|.|.|..         ||||        ..|....::|.|.|.....
Mouse   168 -----------------RADNGEEGANLGGGWKLTEEP--------PPPPPLPRRKGPLPAGPTP 207

  Fly   196 DDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKK-RGTCFTVFCQQLARSCSRYCCDECGNFT 259
            ||...|...|  |.:|..          .||...|| :|        ...|...:...|.|  ..
Mouse   208 DDVPGPPKRK--EREGGN----------EPPTPRKKVKG--------GRERHLKKVGGDAC--LL 250

  Fly   260 AITNVFALGLLPNM---PAMKVAMGHVGLLLGNDLTNNQKSNKNSEASESKTETKPKVKKPKSEG 321
            ...:..:.||||..   |:...:..|.||    ...|.:|......::|......|..::.|.| 
Mouse   251 RGADPGSPGLLPPRVLNPSQAFSSCHPGL----PPENWEKPKPPIASAEGPAVPSPSPQREKLE- 310

  Fly   322 RKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLVEE---SRSETERHKAKHKTSK 383
               |::.....|||.||.|.:::       :..|.|..|...|.|:   ..:...|..|:..:.:
Mouse   311 ---RFKRMCQLLERVPDTSSSSS-------DSDSDSDSSGTSLSEDEAPGEARNGRRPARGSSGE 365

  Fly   384 KEKTSSQRA-----------YSLSPIPSPKSYRAARNTSETAPNSP 418
            ||....:||           :.|.|.|.|:..:..|:.....|.||
Mouse   366 KENRGGRRAIRPGTGGPLLSWPLGPAPPPRPPQLERHVVRPPPRSP 411

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 9/46 (20%)
Fbxl19XP_006507816.1 zf-CXXC <52..79 CDD:251032
PHD_FXL19 89..150 CDD:277115 14/99 (14%)
F-box-like 426..469 CDD:289689
AMN1 468..667 CDD:187754
leucine-rich repeat 488..511 CDD:275381
leucine-rich repeat 512..535 CDD:275381
leucine-rich repeat 573..600 CDD:275381
leucine-rich repeat 601..627 CDD:275381
leucine-rich repeat 631..655 CDD:275381
leucine-rich repeat 656..680 CDD:275381
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.