DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and BPTF

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_005257207.1 Gene:BPTF HGNCID:3581 Length:3158 Species:Homo sapiens

Alignment Length:518 Identity:115/519 (22%)
Similarity:170/519 (33%) Gaps:175/519 (34%)


  Fly    26 CRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQ--HDTYYCTECFRKNPLLKCTYKKSPSTTG- 87
            ||..|..|.::||:.|:..:|.:|:..|.   |:  .|.:.|.         .|...|.|..|. 
Human   393 CRVCHKLGDLLCCETCSAVYHLECVKPPL---EEVPEDEWQCE---------VCVAHKVPGVTDC 445

  Fly    88 VPKTPKT-PKTPKTP-----------------------KNPKTPKTPKNSKTPKTARIINSIG-- 126
            |.:..|. |.....|                       :|....|....|...:.|.:|:.:.  
Human   446 VAEIQKNKPYIRHEPIGYDRSRRKYWFLNRRLIIEEDTENENEKKIWYYSTKVQLAELIDCLDKD 510

  Fly   127 ------------VRQNPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTED--AEKVD- 176
                        :|:...|.....:    ::.|.:|.|.|...|.    |.||..|.  |:|.| 
Human   511 YWEAELCKILEEMREEIHRHMDITE----DLTNKARGSNKSFLAA----ANEEILESIRAKKGDI 567

  Fly   177 ---QKPKKTAKKKNPKPEDKVTDDAQKPAVEKLFESKGTQCNMFRDWSKYVP---PENSKKRGTC 235
               :.|::|.|.||....|  :.||:|...|  ||.:..:    :|.....|   ||..|.... 
Human   568 DNVKSPEETEKDKNETEND--SKDAEKNREE--FEDQSLE----KDSDDKTPDDDPEQGKSEEP- 623

  Fly   236 FTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNKN 300
                             .|.|:                             .||.::.|...|..
Human   624 -----------------TEVGD-----------------------------KGNSVSANLGDNTT 642

  Fly   301 SEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKLV 365
            :..||   ||.|      |||     |||...|..:||.|..|.|  |:..|||........|..
Human   643 NATSE---ETSP------SEG-----RSPVGCLSETPDSSNMAEK--KVASELPQDVPEEPNKTC 691

  Fly   366 EESRSETE----RHKAKHKTSKKEKTSSQRAYSLSPIPSPKSYRAARN--TSETAPNSPVNLKK- 423
            |.|.:...    :...::..|..|..|||          .:|.:||.:  ..|...::||:::: 
Human   692 ESSNTSATTTSIQPNLENSNSSSELNSSQ----------SESAKAADDPENGERESHTPVSIQEE 746

  Fly   424 ---TFKQK----HVISSPTGKKRVCRSQTI-----SADDPLPSQPKSTEVSPMASAGTSSSNK 474
               .||.:    .:..||...|....|..|     :.|..| ||.||.:|    :|....:||
Human   747 IVGDFKSEKSNGELSESPGAGKGASGSTRIITRLRNPDSKL-SQLKSQQV----AAAAHEANK 804

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 13/44 (30%)
BPTFXP_005257207.1 DDT 241..297 CDD:280886
WHIM1 339..388 CDD:292246
PHD1_BPTF 392..434 CDD:277034 13/53 (25%)
Med15 2217..>2598 CDD:255446
TNG2 2742..2972 CDD:227367
PHD2_3_BPTF 2923..2969 CDD:277035
PHD2_3_BPTF 2981..3027 CDD:277035
Bromo_gcn5_like 3043..3143 CDD:99941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.