DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG3347 and Bptf

Sequence 1:NP_001285579.1 Gene:CG3347 FlyBaseID:FBgn0031513 Length:538 Species:Drosophila melanogaster
Sequence 2:XP_006532738.1 Gene:Bptf MGIID:2444008 Length:3158 Species:Mus musculus

Alignment Length:581 Identity:112/582 (19%)
Similarity:180/582 (31%) Gaps:222/582 (38%)


  Fly    26 CRQSHINGFMICCDNCNEWFHGDCIGLPANIGEQ--HDTYYCTECFRKNPLLKCTYKKSPSTTG- 87
            ||..|..|.::||:.|:..:|.:|:..|.   |:  .|.:.|.         .|...|.|..|. 
Mouse   405 CRVCHKLGDLLCCETCSAVYHLECVKPPL---EEVPEDEWQCE---------VCVAHKVPGVTDC 457

  Fly    88 VPKTPKT-PKTPKTP-----------------------KNPKTPKTPKNSKTPKTARIINSIG-- 126
            |.:..|. |.....|                       .|....|....|...:.|.:|:.:.  
Mouse   458 VAEVQKNKPYVRHEPIGYDRSRRKYWFLNRRLIIEEDTDNENEKKVWYYSTKVQLAELIDCLDKG 522

  Fly   127 --------VRQNPRRRSTFVQERPSEVPNPSRQSTKLQKAVNYENATEEPTEDAEKV-------- 175
                    |.::.|.......:...::.|.:|.|.|     ::..|..|...|:.::        
Mouse   523 YWEAELCRVLEDIREEMQQHMDVTEDLTNKARGSNK-----SFLAAANEEILDSLRIKRGEDIDC 582

  Fly   176 DQKPKKTAKKK------NPKPEDKVTDDAQKPAVEKLFESKGTQCNMFRDWSKYVPPENSKKRGT 234
            ||.|:...|.|      :.|..:|..::|:.|:.:|..:|||.:     :...:..||...:.| 
Mouse   583 DQSPEDPEKDKHEGENNSSKDAEKSREEAEDPSADKDADSKGLE-----EEPGHGKPEEPTEVG- 641

  Fly   235 CFTVFCQQLARSCSRYCCDECGNFTAITNVFALGLLPNMPAMKVAMGHVGLLLGNDLTNNQKSNK 299
                               :.||              ::||.          ||::.||      
Mouse   642 -------------------DKGN--------------SVPAN----------LGDNTTN------ 657

  Fly   300 NSEASESKTETKPKVKKPKSEGRKSRYRSPSSSLERSPDVSRTAAKRPKLQEELPSSSSRSSRKL 364
                 .|..||.|      .:|     |||...|..:.|.|..|.|  |:..|||......|.:.
Mouse   658 -----ASPEETSP------CDG-----RSPEGCLSETHDSSSMAEK--KVASELPPDVPEDSNRT 704

  Fly   365 VEESRSETERHKAKHKTSKKEKTSSQRAYSLSPIPSPKSYRAARNTSETAPNSPVNLKKTFKQKH 429
            .:.|                                        |||.|..:|..|| :|.....
Mouse   705 CDSS----------------------------------------NTSATTASSQPNL-ETCSSSE 728

  Fly   430 VISSPTGKKRVCRSQTISADDP-LPSQPKSTEV--------------------SPMASAGTSSSN 473
            :.||.:...:       :|||| :..:...|.|                    ||.|..|||.|.
Mouse   729 LTSSQSDSAK-------AADDPEIGERDSHTPVSVHEEIGDFRLEKSNGEVSESPGAGKGTSGST 786

  Fly   474 ------KKPVPETSCQKYRKLSFTDENCEKI----KIIRCIVSNMSPTEKALLARKRMMMK 524
                  :.|..:.|..|.::::.......|:    |.:  :|.|.......|..:|.::||
Mouse   787 RIITRLRNPESKLSQLKSQQVAAAAHEANKLFKEGKEV--LVVNSQGEVSRLSTKKEVVMK 845

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3347NP_001285579.1 PHD_SF 23..68 CDD:304600 13/44 (30%)
BptfXP_006532738.1 DDT 253..309 CDD:280886
WHIM1 351..400 CDD:292246
PHD1_BPTF 404..446 CDD:277034 13/53 (25%)
Adeno_PIX 2259..2348 CDD:281888
PHD2_3_BPTF 2923..2969 CDD:277035
PHD2_3_BPTF 2981..3027 CDD:277035
Bromo_gcn5_like 3043..3143 CDD:99941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1632
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.